KEGG   Bos taurus (cow): 527051
Entry
527051            CDS       T01008                                 

Gene name
CIDEA
Definition
(RefSeq) cell death activator CIDE-A
Organism
bta  Bos taurus (cow)
SSDB
Motif
Pfam: CIDE-N GCV_T
Other DBs
NCBI-GeneID: 527051
NCBI-ProteinID: NP_001076918
BGD-bta: BT10567
UniProt: A4FUX1
Position
24
AA seq 219 aa
METARDCAGALLRPLTFMGSQTKKVLFTPFMHPARPFRVSNHDRSSRRGVMASSLQELLS
KTLDALVVASQLVTLVLEEDGTVVDTEEFFQTLGDNTHLMVLEQGQKWTPAGHQTPARRP
PQRRGIAKVTFDLYKLSPKDVIGCLNVKATMYEMYSVSYDIHCTGFKAMLRSLLRFLSHA
AQVTGQCLIHMGTYMLRVLAETEEQAVPGSRPWRGIKRG
NT seq 660 nt   +upstreamnt  +downstreamnt
atggagactgcccgggactgcgccggagccctgctcaggcccctgacgtttatggggtcg
cagacaaagaaggtgctgttcacacccttcatgcatcccgctcgccccttccgtgtctcc
aaccatgaccggagcagccgccgaggggtgatggccagtagcctacaggagcttctcagc
aagaccttggatgcactggtggtcgccagccaactggtcaccttggtgctggaggaggat
ggcactgtggtggacacagaggagttcttccagaccctgggggacaacacacacctcatg
gtcctggagcaggggcagaaatggacaccggctggccaccaaaccccagcccgccggccg
cctcagagacggggcatcgcgaaagtcaccttcgacttgtacaagctgagccccaaggat
gtcattggctgcctcaacgtgaaggccaccatgtacgagatgtattctgtgtcctacgac
atccactgcacagggttcaaggccatgctcaggagcctgctgcgattcctctctcacgct
gcccaggtgactggccagtgtcttatccacatgggcacctacatgctccgagtgctggct
gaaacagaggagcaggcggtgcctggctcgcgcccttggagagggatcaagagagggtag

DBGET integrated database retrieval system