KEGG   Bos taurus (cow): 527214
Entry
527214            CDS       T01008                                 

Gene name
PLA2G12A
Definition
(RefSeq) group XIIA secretory phospholipase A2 precursor
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
bta  Bos taurus (cow)
Pathway
bta00564  Glycerophospholipid metabolism
bta00565  Ether lipid metabolism
bta00590  Arachidonic acid metabolism
bta00591  Linoleic acid metabolism
bta00592  alpha-Linolenic acid metabolism
bta01100  Metabolic pathways
bta04014  Ras signaling pathway
bta04270  Vascular smooth muscle contraction
bta04972  Pancreatic secretion
bta04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    527214 (PLA2G12A)
   00565 Ether lipid metabolism
    527214 (PLA2G12A)
   00590 Arachidonic acid metabolism
    527214 (PLA2G12A)
   00591 Linoleic acid metabolism
    527214 (PLA2G12A)
   00592 alpha-Linolenic acid metabolism
    527214 (PLA2G12A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    527214 (PLA2G12A)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    527214 (PLA2G12A)
  09154 Digestive system
   04972 Pancreatic secretion
    527214 (PLA2G12A)
   04975 Fat digestion and absorption
    527214 (PLA2G12A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bta03036]
    527214 (PLA2G12A)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     527214 (PLA2G12A)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    527214 (PLA2G12A)
SSDB
Motif
Pfam: PLA2G12
Other DBs
NCBI-GeneID: 527214
NCBI-ProteinID: NP_001091532
BGD-bta: BT29660
Ensembl: ENSBTAG00000015230
VGNC: 32954
UniProt: A5D7L0
Position
6
AA seq 185 aa
MALLAVLLVLFLTAGGRCQEQAQTTDWRATLKTIRNGVHKIDMYLNAALDLLGGEDGLCQ
YKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDC
DEAFQSCLSKICRDVQKTLGLAQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCRYE
EKTDL
NT seq 558 nt   +upstreamnt  +downstreamnt
atggccctgctcgcagtcctcctggtcctcttcctgaccgccggtgggaggtgccaggag
caagcccagaccaccgactggagggccaccctgaagaccatccggaacggcgttcacaag
attgacatgtatctgaacgccgccttggacctcctgggaggcgaggacgggctctgccag
tataagtgcagtgacggatctaagcctttcccacgttatggatataaaccctccccaccg
aatggatgtggctccccactgtttggtgttcatcttaacatcggcatcccttccctgaca
aagtgctgcaaccaacatgaccggtgctatgagacctgtggcaaaagcaaaaacgactgt
gatgaggcgtttcagtcttgcctatccaagatttgcagagatgtgcagaaaacactgggg
ctggctcagcacgtgcaggcctgtgaaaccactgtggagctcttgtttgacagcgtcata
cacttaggctgtaagccgtacttggacagccaacgagccgcatgtaggtgtcgctacgaa
gaaaaaaccgatctttga

DBGET integrated database retrieval system