KEGG   Bos taurus (cow): 528100
Entry
528100            CDS       T01008                                 

Gene name
SERP1
Definition
(RefSeq) stress-associated endoplasmic reticulum protein 1
Organism
bta  Bos taurus (cow)
SSDB
Motif
Pfam: RAMP4 DUF1206 DUF4079
Other DBs
NCBI-GeneID: 528100
NCBI-ProteinID: NP_001107555
BGD-bta: BT12592
Ensembl: ENSBTAG00000009104
VGNC: 34464
UniProt: Q3ZBR1
Position
1
AA seq 66 aa
MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQ
SIRMGM
NT seq 201 nt   +upstreamnt  +downstreamnt
atggttgccaagcagcggatccgtatggccaacgagaagcacagcaagaatatcacccag
cgcggcaacgtcgccaagacctcgagaaatgctcctgaagagaaggcgtctgtaggaccc
tggttattggctctcttcatttttgttgtttgtggttctgcaattttccagattattcaa
agtatcaggatgggcatgtga

DBGET integrated database retrieval system