KEGG   Bos taurus (cow): 528123Help
Entry
528123            CDS       T01008                                 

Gene name
WLS
Definition
(RefSeq) protein wntless homolog
Organism
bta  Bos taurus (cow)
SSDB OrthologParalogGFIT
Motif
Pfam: MIG-14_Wnt-bd
Motif
Other DBs
NCBI-GeneID: 528123
NCBI-ProteinID: NP_001179580
BGD-bta: BT28539
Ensembl: ENSBTAG00000012976
VGNC: 36948
UniProt: E1BDN1
Position
3
AA seq 541 aa AA seqDB search
MAGAIIENMSTKKLCIVGGILLVFQIIAFLVGGLIAPGPTTAVSYMSVKCVDVRKNHHKA
KWLMPWGPNQCDKIRDIEEAIPREIEANDIVFSVHIPLPSMEMSPWFQFMLFILQLDIAF
KLNNQIRENAEVSMDVSLAYRDDMFAEWTEMAHERVPRKLKCTFTSPKTLEHEGRYYECD
VLPFMEIGSVAHKYYLLNIRLPVNEKKKINVGIGEIKDIRLVGIHQNGGFTKVWFAMKTF
LTPSIFIIMVWYWRRITMMSRPPVLLEKVIFALGISMTFINIPVEWFSIGFDWTWMLLFG
DIRQGIFYAMLLSFWIIFCGEHMMDQHERNHIAGYWKQVGPIAVGSFCLFIFDMCERGVQ
LTNPFYSIWTTDVGTELAMAFIIVAGICLCLYFLFLCFMVFQVFRNISGKQSSLPAMSKV
RRLHYEGLIFRFKFLMLITLACAAMTVIFFIVSQVTEGHWKWGGVTVQVNSAFFTGIYGM
WNLYVFALMFLYAPSHKNYGEDQSNGDLGVHSGEELQLTTTITHVDGPTEIYKLTRKEAQ
E
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggctggggcaattatagaaaacatgagcaccaagaagctgtgcattgttggtgggatt
ctgcttgtgttccaaatcatcgcctttctggtgggaggcttgattgctccaggacccaca
acggcagtatcctacatgtcagtgaaatgtgtggatgtccgtaaaaaccatcacaaggca
aaatggttaatgccttggggacccaaccaatgtgacaagatccgagacatcgaggaagca
attccaagggaaattgaagccaatgacattgtgttttctgtccacatccccctcccttcc
atggagatgagtccttggttccagttcatgctgtttatcctgcagctggacattgcattc
aagctgaacaaccaaatcagagaaaatgcagaagtttccatggatgtttctctggcttac
cgtgatgatatgtttgctgagtggactgaaatggcccatgagagagtgccccggaaactc
aaatgtaccttcacctcccccaagaccctagaacatgagggccgttactatgaatgtgat
gtccttcctttcatggaaattgggtccgtggctcataagtattaccttctaaatatccgg
ctgcctgtgaatgagaagaagaaaatcaacgttgggattggagagataaaggatattcgg
ctggtgggaattcaccagaatggaggcttcaccaaggtgtggtttgccatgaagaccttc
cttacacccagcatcttcatcattatggtgtggtattggaggaggatcaccatgatgtct
cgacccccagtcctcctagaaaaagtcatctttgcccttgggatttccatgacttttatc
aacatcccagtggagtggttttccattgggtttgactggacctggatgctcttgtttggt
gatatccgacagggcatcttctacgcaatgcttctctccttctggatcatcttctgtggt
gagcacatgatggaccagcatgagcggaatcatatagcagggtattggaagcaagtcgga
ccaattgctgttggctctttctgccttttcatatttgacatgtgtgagagaggggtacaa
ctcacgaatcccttctacagtatctggactacagatgtcggaacagaactggctatggcc
ttcatcatagtggctgggatctgcctctgcctctacttcctgtttctgtgcttcatggtc
tttcaggtttttcggaacatcagcgggaagcaatcaagcctgccagccatgagcaaagtc
cggcggctacactatgaggggctaattttcaggttcaagttcctcatgcttatcaccttg
gcctgtgctgccatgactgtcatcttcttcattgttagtcaggtgactgaaggccattgg
aagtggggtggtgtcacagtccaagtgaacagtgcctttttcactggcatctatggcatg
tggaacctgtatgtctttgctttgatgttcttgtacgcgccatcccataagaactatggg
gaagaccaatccaacggtgatctgggtgtacacagtggggaagaactccagctcaccacc
actatcacccacgtggacgggcccactgagatctacaagttgacccgcaaggaggcccag
gagtag

DBGET integrated database retrieval system