KEGG   Bos taurus (cow): 529373Help
Entry
529373            CDS       T01008                                 

Gene name
KAT6A
Definition
(RefSeq) histone acetyltransferase KAT6A isoform X1
  KO
K11305  histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
bta  Bos taurus (cow)
Pathway
bta04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:bta00001]
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    529373 (KAT6A)
Enzymes [BR:bta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     529373 (KAT6A)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    529373 (KAT6A)
   HAT complexes
    MOZ/MORF complex
     529373 (KAT6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MOZ_SAS PHD Linker_histone Acetyltransf_7 PHD_2 PHD_4 HTH_Mga Acetyltransf_1
Motif
Other DBs
NCBI-GeneID: 529373
NCBI-ProteinID: XP_024842202
BGD-bta: BT19565
Ensembl: ENSBTAG00000004015
VGNC: 30401
Position
27
AA seq 2020 aa AA seqDB search
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKS
IERFLKGQKDVSALFGGGAASGLHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGKE
SCESLSSLPPVSLLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPS
CLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRM
PKGMWICQICRPRKKGRKLLQKKAAQIKRRYANPIGRPKNRLKKQNTVSKGPFSKVRTGP
GRGRKRKITLSSQSASSSEEGYLEQIDGLDFCRDGSVPLKFNKKTKGLIDGLTKFFTPSP
DGRKPRGEVVDYSEQYRARKKGSRKPSTSDWPTDNQDGWDGKQESEDRLFGSQEIMTEKD
MELFRDIQEQALQKVGVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCE
FCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFL
DHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRF
LIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLTG
ICPQDITSTLHHLRMLDFRSDQFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTPVIV
SNSVVSEEEEEEEEEEEEEEEEEEEREPEERQSQEELEPSVRVGKSASRENKEQDSYTSV
ESEKKPEVVTPANTTRLSKQVLPRDSLAANSQPSRRGRWGRKNRKAQERFGDKDPKLLLE
ETSAPQEQYGDCEEKSEPSQEQYMENEEPLAASQEQPNQDGKPDGPKRRPGEGLELWRGP
PKKSPEPLKCGLPDAHDRLPRRYSEGRYCEGRYADGDRPALRGCSESSEEDGEPESPRSS
SPPVLTKPTLKRKKPILHRRRRVRKRKHHNSSVVTETISETTEVLDEPFEDSDSERPMPR
LEPTFEIDEEEEEEDESELFSRGYFHRLASQDVLRCRSDSKRKSKDEDDDEESDDADDTP
VLKPVSLLRKCDVKDAPLEPDTSTPMKKKKGWPKGKSRKPVHWKKRPGRKPGFKLSREMV
PLSAQECIVEPIVPLPKAGRKSKMEESEETVEPQEDLPLTEERKEEEELPLEAEEVEEGE
EEDTTSSDVRAAASPAEPSSPEAEAKEPEAGEEEEKPRVPAEQRPSEEAPQELARPEPEE
EEDTAAETNQSEDHDADDEDDGHLEPAKKEEEPGEPPAREGVKEEPGGREAFLDPNVQGS
GENPKDKEETEPDSEEEQTSHDASVVSEHMPGSEDDREEDSRSKEELLELKEEEEIPHSE
LDLETVQAVQSLTQEERGEHEGAYQDCEETLAACQTLQSYTQADEDPPLALVEDCHASEH
NSPLSSVQSHPSQSVRSVSSPSVPALEGGYTQISPEQGSLSAPSMQNMETSPMMDVPSVS
DHSQQVVDSGFSDLGSIESTTENYENPSSYDSTMGSSICGNSSSQSSCSYGLSSSSSLTQ
NSCVVTQQMAGMGGGCSLMPQSSVPPAANCGIKSPQSCAVERPPSTQQPPPPQPSQQPPP
PQPQPPAPPPPPAQPPPPPPPPPQQPQPPPPPQQQPPLSQCSMNNSFTPAPMIMEIPESG
SAGNISIYERIPGDFGAGSYSQPSATFSLAKLQQLTNTIMDPHAMPYSHSPAVTSYATSV
SLSNTGLAQLAPSHPLAGTPQAQATMTPPPNLASTTMNLTSPLLQCNMSATNIGIPHTQR
LQGQMPVKGHISIRSKSAPLPSAAAHQQQLYGRSPPAVAMQAGPRALAVQRGMNMGVNLM
PTPAYNVNSMNMNTLNAMNSYRMTQPMMNSSYHSNPAYMNQTAQYPMQMQMGVMGGQAYP
QQPMQPSPHGNVMYTGPSHHSYMNAAGVPKQSLNGPYMRR
NT seq 6063 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaactcgccaacccgctgtacacggagtggattttggaggccatcaaaaaagtg
aagaagcaaaaacagcggccttcagaagaaaggatatgcaatgcagtgtcttcatcccat
ggcttggatcgtaaaactgttttagagcaactggagttgagtgtcaaggatggaacaatt
ttgaaggtctcaaataaaggactcaattcctataaagatcctgataatcctgggcgaata
gcacttcctaaacctcgaaaccatggaaaattggataataagcaaaatgtagactggaat
aaactgatcaagagggcagttgagggcttggcggagtccggcggctcaactctgaaaagc
attgaacgttttttgaaaggtcagaaggatgtgtctgcattatttggaggcggtgctgcc
tctggccttcaccagcagttacgattggctattaaacgcgccattggccacggcagactc
cttaaagatggacctctttatcggctcaacactaaagcaaccaatgtggatgggaaagag
agttgtgagtctctttcctctttacctccagtgtcactccttccacatgaaaaggataag
ccggttgctgaacccatccccatctgtagtttctgtcttggcacaaaagagcaaaaccga
gaaaagaagccagaggaactcatctcctgtgcggactgcggcaacagcggtcatccatcc
tgtttgaagttttcccccgaactaacggttagagtgaaggccttacggtggcagtgcatt
gagtgtaaaacgtgcagttcctgtcgagaccaaggcaaaaatgcagataacatgctcttt
tgtgattcctgtgaccggggttttcacatggaatgttgtgatccgccactcactcggatg
ccaaaaggcatgtggatatgtcagatatgtcgacctaggaaaaaaggaagaaagcttcta
cagaagaaggcagcacagataaaacggcgctatgctaacccaataggacgcccaaaaaac
aggttaaagaaacaaaacacggtgtcaaaaggtcccttcagcaaagttcgaacaggccct
ggaaggggtcggaaacgtaaaatcactctctccagccagtcagcatcgtcatcagaagaa
ggatacttagagcaaatagatggcttggacttctgcagagatggcagtgtccccttgaag
ttcaataagaaaaccaaagggctcatcgacggccttaccaaattctttaccccttctccc
gatgggcgtaagcctcggggggaagtggtagactattctgagcaatacagagctaggaaa
aagggcagcagaaagccaagcacttcagattggcccacagacaatcaggatggctgggat
ggcaaacaggaaagcgaggaccggctttttgggagccaggaaatcatgactgagaaggat
atggaattgtttcgtgacatccaagaacaagccctgcagaaagttggagtgactggtcct
cctgatccacaagtccgctgtccctctgttattgagtttgggaagtatgaaattcatacc
tggtactcctctccatatcctcaagaatactcaaggctgcctaaattatatctctgtgaa
ttctgtctaaaatatatgaaaagtagaactattctgcagcagcatatgaagaagtgtggt
tggttccatcctcctgctaatgagatttatagaaagaataacatttctgtttttgaggtt
gatgggaatgtgagtaccatttattgtcagaacctgtgtctcttggcaaagttgtttctt
gaccacaaaacactctattatgacgtggagccatttcttttttatgttctaacccagaat
gatgtcaagggctgccaccttgttggctacttttctaaagaaaagcactgtcaacagaaa
tataacgtttcctgtataatgattcttccccagtaccaacgcaagggctatgggaggttt
ctcatcgatttcagttatttgttatcaaagcgtgaaggccaagcagggtctccagagaaa
ccattatccgatctaggtcgcctttcctacatggcttactggaaaagtgtaatattggag
tgcctttatcaccaaaatgataagcagatcagcattaagaagttgagtaagttgactgga
atctgccctcaagacatcacttccacactgcaccacctgcgcatgctggacttccggagt
gaccaatttgtgattatccgccgggaaaagcttatccaggatcacatggcaaagcttcag
ctgaatctgcggcctgtagatgtagatcccgagtgtttgcgctggactcctgtcatagtc
tccaattctgttgtctcagaggaggaggaggaggaggaggaagaggaggaggaggaggaa
gaggaggaggaggagagagagccggaagagcgtcagagccaggaagaattggagccaagt
gtaagggtggggaagtctgcatctcgagagaacaaagaacaggattcttacacttcagta
gaaagtgaaaagaaaccagaagttgtgacaccagccaataccactcgattgagcaaacag
gtccttccccgtgacagtcttgctgccaacagtcagccatctcggcgaggccgctggggg
aggaagaacagaaaagcccaggaacgctttggtgataaggacccgaaactgctcttggag
gagacgtcagccccccaggagcagtacggagactgtgaggaaaagtcagaaccttcccaa
gagcagtacatggagaacgaggagcctttggcagcctcccaggagcagccgaaccaggac
gggaagccagacgggcccaagaggagacccggcgaggggctcgagctctggcgaggcccg
ccgaagaagagccctgagccgctgaagtgcgggctgcccgacgcccacgaccggctgccc
cgtcgctacagcgagggtcgctactgcgaaggccgctacgctgacggggaccgccccgcg
ctgcggggctgcagcgagagcagcgaggaggacggggagcccgagagcccccggtccagc
tcacccccggtgctcaccaagcccacgctgaagcggaagaaaccaattcttcaccgaaga
aggagagtccgaaaacgcaaacaccacaatagcagtgttgtcacagagaccatttctgag
accacggaggtcttggacgagccttttgaagactccgactccgagaggccgatgccgaga
ttagagccaacgttcgagattgatgaggaggaggaagaagaggatgagagtgaactcttc
tctcgagggtacttccatcgcttggcctcccaggacgttctcaggtgtcggtctgattct
aagaggaagtctaaagatgaagacgatgacgaagagtcagatgatgctgatgacactcct
gtcctaaagccagtgtctctcttgagaaaatgtgatgtgaaggacgctccacttgagcca
gatacatccacgcccatgaagaagaagaagggatggcccaagggcaagagccgcaaacca
gtccactggaaaaagagacctggtcgcaagccgggctttaagctgagtcgggagatggtg
cccctctctgctcaagagtgcatcgttgagcccatcgtcccccttccgaaagcgggacgt
aaatccaaaatggaagaaagcgaagaaactgttgaaccccaagaagacttgcctttaacg
gaggaaaggaaggaagaggaggagttgcccctggaagcggaggaggtcgaggagggggaa
gaggaggacaccaccagcagtgacgtcagggcggcggcctctcccgccgaacccagcagc
ccggaggccgaagccaaggagcccgaggccggtgaggaagaggagaagccccgcgtcccg
gcagagcagcggccgtcggaggaggcgccgcaggagctggccaggccggagcccgaggag
gaggaggacacggccgcagagacaaaccagagcgaagaccacgatgcggacgacgaggac
gacggccacctggagcccgccaagaaggaggaggagccgggggagccgccggcgcgggag
ggcgtcaaggaggagcctggcggccgggaggcttttttagatcctaatgtgcagggcagt
ggggagaacccgaaagacaaggaggagacggagccggattccgaggaggagcagacttcg
cacgatgcgtccgtggtgtcggagcacatgccgggctctgaggacgaccgcgaggaggac
tcgcgctcgaaggaggagctgctggagctgaaggaggaggaggagatcccgcacagcgag
ctggacctggagacggtgcaggccgtgcagtccctgacgcaggaggagcgcggcgagcat
gagggcgcctaccaggactgcgaggagactctggccgcctgccagacgctgcagagttac
acgcaagccgacgaggacccgccactggccctggtggaggactgccacgcctctgagcac
aacagcccgctgtcctccgtccagtcccaccccagccagtcggtgcgctcggtcagcagc
cccagcgtgcccgccctcgaagggggctacacccagatcagcccggagcaaggatccctg
tccgccccgtctatgcagaacatggagaccagccccatgatggatgtgccttccgtatcc
gaccactcccagcaggtggtggacagcggcttcagcgacctgggcagcattgagagcacc
acagagaactacgagaaccccagcagctacgactccactatgggcagcagcatctgtggg
aacagctcctcccagagcagctgctcctacggcctgtcgtcctccagcagcctcacccag
aacagctgcgtggtcacccagcagatggctggcatgggtggcggctgcagcctgatgcca
cagagtagcgtcccgcccgctgccaactgtggcatcaagtccccacagagctgtgccgtt
gagaggcctcccagcactcagcagccgccgccgccccagccatcgcagcagcctccaccg
ccacagcctcagccgccagccccgcccccaccgcctgcccagccgccgcccccacccccg
ccgccgccccagcagccacagcccccacccccgccccagcaacagcccccgctgtcgcag
tgcagcatgaacaacagcttcactccggcgcccatgatcatggagatccccgagtccggc
agtgcggggaacatcagcatctacgagcggatccccggggacttcggggccggcagctac
tcccagccgtcggccaccttcagtctggccaagttgcagcagctgaccaacaccattatg
gacccccatgccatgccttatagccattctcctgctgtgacttcctatgcaaccagtgtt
tctctgtccaacacgggactggctcagctggctccatcgcatcccttagcagggacccct
caagcacaagccaccatgacaccgcccccgaacttggcctccaccaccatgaacctcacg
tcccctctgctgcagtgcaacatgtctgccaccaacattggcattccccacactcagagg
ctgcaagggcagatgcccgtcaaggggcacatttccatccgctccaagtcggcgcccctg
ccctccgcggcggctcaccagcagcagctgtacggccgcagcccgcccgcggtcgccatg
caggccggcccacgtgccttggccgtgcagcgtggcatgaacatgggggtgaacttgatg
cccacccctgcctataatgtcaattccatgaatatgaacaccctgaacgccatgaacagc
tatcgaatgacccagcccatgatgaacagcagttaccatagtaacccggcctacatgaac
cagacagcacagtatcctatgcagatgcagatgggggtgatggggggccaggcctacccc
cagcagcctatgcagccgagcccgcacggaaacgtgatgtacacgggcccctcccatcac
agctacatgaacgcggcgggcgtgcccaagcagtcgctcaacggaccttacatgagaaga
tga

DBGET integrated database retrieval system