KEGG   Bos taurus (cow): 529500
Entry
529500            CDS       T01008                                 

Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bta03000]
    529500
Transcription factors [BR:bta03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    529500
SSDB
Motif
Pfam: HLH PAS
Other DBs
NCBI-GeneID: 529500
NCBI-ProteinID: NP_001071450
BGD-bta: BT13984
UniProt: Q0IIA1
Position
20
AA seq 164 aa
MIPPGECLYAGRKRRKPVQKKRPAVGAEKSNPSKRHRDRLNAELDHLASLLPLPPDIISK
LDKLSVLRLSVSYLRVKSFFQALQERCPRQPVAAAPSPGDRGPRGGSAGSTVLEGRLLLE
SLHGFALVVSAEGMIFYASATIVDYLGFHQVSTAPRLLGSVPLP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgatcccaccgggggagtgcctgtacgccgggagaaaacgcaggaagcccgttcagaaa
aagaggcctgccgtgggcgctgagaagtcgaacccttccaagcggcaccgggaccgcctc
aatgccgagctggaccacctggccagcctgctgccgctgccgcccgacatcatctctaag
ctcgacaagctttctgtcctgcgtctcagcgtcagctatctcagggtgaaaagcttcttc
caagccctgcaggagaggtgcccgaggcagccggtggctgctgccccctcgccgggagac
cggggtccacgcggagggtctgcaggctcgaccgtgctggagggaaggctgctgctggag
tctctccacggcttcgctctggtggtgagcgcggaagggatgatcttctacgcgtcggcc
acgatcgtggactacctgggcttccaccaggtaagcacagcgccccgtctgctgggttca
gtcccgctgccttga

DBGET integrated database retrieval system