KEGG   Bos taurus (cow): 529904Help
Entry
529904            CDS       T01008                                 

Gene name
GRIA4
Definition
(RefSeq) glutamate receptor 4 precursor
  KO
K05200  glutamate receptor 4
Organism
bta  Bos taurus (cow)
Pathway
bta04024  cAMP signaling pathway
bta04080  Neuroactive ligand-receptor interaction
bta04713  Circadian entrainment
bta04723  Retrograde endocannabinoid signaling
bta04724  Glutamatergic synapse
bta04728  Dopaminergic synapse
bta05031  Amphetamine addiction
bta05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    529904 (GRIA4)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    529904 (GRIA4)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    529904 (GRIA4)
   04728 Dopaminergic synapse
    529904 (GRIA4)
   04723 Retrograde endocannabinoid signaling
    529904 (GRIA4)
  Environmental adaptation
   04713 Circadian entrainment
    529904 (GRIA4)
 Human Diseases
  Substance dependence
   05031 Amphetamine addiction
    529904 (GRIA4)
   05033 Nicotine addiction
    529904 (GRIA4)
Ion channels [BR:bta04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   529904 (GRIA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 529904
NCBI-ProteinID: NP_001073072
BGD-bta: BT10464
UniProt: A0JN75
Position
15
AA seq 433 aa AA seqDB search
MRIICRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH
VSAICVENFSDVNYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVQIQGLTGN
VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIGNRTVVVT
TIMPLMKNPILRN
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaggattatttgcagacagattgtcttgttattttctggattttggggactcgccatg
ggagcctttccgagcagcgtgcaaataggtggtctcttcatccgaaacacagatcaggag
tacactgcttttcgattagcaatttttcttcataacaccagccccaatgcgtcagaagct
ccttttaatttggtacctcatgtggacaacatcgagaccgccaacagctttgccgtaaca
aacgctttctgttcccagtattccagaggagtatttgccatttttggactctatgataag
aggtcagtacataccttgacctcattctgcagcgccttgcatatctccctcatcacacca
agttttcctactgagggggagagccagtttgtgctgcagctaaggccttccttaagagga
gcccttttgagtctgctggatcactatgaatggaactgttttgtattcctgtatgacaca
gacaggggatactcgatacttcaagctattatggaaaaagcaggacaaaatggttggcac
gtcagcgctatatgtgtggaaaattttagtgatgtcaactacaggcaacttttagaagaa
cttgatagaagacaagagaagaaatttgtaatagactgtgaaatagagaggcttcaaaac
atattagaacagattgtgagtgttggaaagcacgttaaaggctaccattatatcattgca
aacttgggattcaaggatatttctcttgagagatttatacatggtggagccaatgttaca
ggattccagttggtagattttaacacacctatggtgaccaaattaatggatcgctggaag
aaattagatcagagagaatatccaggatctgagacacctccaaagtatacatctgctctg
acttatgatggagtccttgtgatggctgaaacattccgaagtctcagaagacagaaaatt
gatatttccaggagaggaaatgctggagattgtctggcaaatccagctgctccatggggc
cagggaattgacatggagaggacactcaaacaggttcaaattcaaggactaacaggaaat
gttcaatttgaccactatggacgtagggtcaattacacaatggatgtgtttgaactaaag
agcacgggacctagaaaggttggatactggaatgatatggataaattagtcttgattcaa
gatgtacccacacttggcaatgacacagcagctattggaaacagaacagttgttgtaacc
actattatgcctctgatgaagaatcctattttaagaaattga

DBGET integrated database retrieval system