KEGG   Bos taurus (cow): 530001Help
Entry
530001            CDS       T01008                                 

Gene name
PIK3CG
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
  KO
K21289  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
bta  Bos taurus (cow)
Pathway
bta00562  Inositol phosphate metabolism
bta04022  cGMP-PKG signaling pathway
bta04072  Phospholipase D signaling pathway
bta04151  PI3K-Akt signaling pathway
bta04261  Adrenergic signaling in cardiomyocytes
bta04371  Apelin signaling pathway
bta04611  Platelet activation
bta04725  Cholinergic synapse
bta04921  Oxytocin signaling pathway
bta05145  Toxoplasmosis
bta05167  Kaposi's sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    530001 (PIK3CG)
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    530001 (PIK3CG)
   04072 Phospholipase D signaling pathway
    530001 (PIK3CG)
   04022 cGMP - PKG signaling pathway
    530001 (PIK3CG)
   04151 PI3K-Akt signaling pathway
    530001 (PIK3CG)
 Organismal Systems
  Immune system
   04611 Platelet activation
    530001 (PIK3CG)
  Endocrine system
   04921 Oxytocin signaling pathway
    530001 (PIK3CG)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    530001 (PIK3CG)
  Nervous system
   04725 Cholinergic synapse
    530001 (PIK3CG)
 Human Diseases
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    530001 (PIK3CG)
   05145 Toxoplasmosis
    530001 (PIK3CG)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     530001 (PIK3CG)
Membrane trafficking [BR:bta04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    530001 (PIK3CG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3K_rbd PI3K_C2 PI3_PI4_kinase DUF3244
Motif
Other DBs
NCBI-GeneID: 530001
NCBI-ProteinID: NP_001095595
BGD-bta: BT26617
Ensembl: ENSBTAG00000020848
VGNC: 32892
UniProt: A6QPT0
Position
4
AA seq 885 aa AA seqDB search
MELENHEQPVVLREDNCRRRRRMKPRSTAASMSSMELIPIEFVLPTSQRNTKTPETALLH
VAGHGNVEQMKAQVWLRVLETSVAADFYHRLGPDHFLLLYQKKGQWYEIYDKYQVVQTLD
CLHYWKVLHRSPGQIHLVQRHSPSEETLAFQRQLTALIGYDVTDVSNVHDDELEFTRRRL
VTPRMAEVAGRDPKLYAMHPWVTSKPLPEYLLKKITNNCIFIIIHRSTTSQTIKVSADDT
PGTILQSFFTKMAKKKSLMDIPESQNEQDFVLRVCGRDEYLVGETPIKNFQWVRQCLKNG
EEIHLVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKIRGIDIPVLPRNADLTVFVEANIQYGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKI
KDLPKGALLNLQIYCGKAPALSGKASAETPSPESRGKAQLLYYVNLLLIDHRFLLRHGEY
VLHMWQLSGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKDPKAYPKLFSSVKWGQ
QEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGTAMLRDFTQQVQVIDMLQKVTIDIKSLSAEKYDVSSQVIFQLKQKLEILQNLNLP
QSFRVPYDPGLKAGALVIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQ
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGNHQHEPGK
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atggagctggagaaccatgaacagcctgtggtgctgagagaggacaactgccgcaggcgc
cggaggatgaagccacgcagcacggcggccagcatgtcctccatggagctcatccccatt
gagttcgtgctgcccaccagccaacgcaacaccaagacccccgaaacggcgctgctgcac
gtggccggccacggcaacgtggagcagatgaaggcccaagtgtggctgcgcgtgctggag
accagcgtggccgccgacttctaccacaggctgggcccggaccacttcctcctgctctac
cagaagaaggggcagtggtatgagatctatgacaagtaccaggtggtgcagaccctggac
tgcctgcactactggaaggtgctgcaccggagccccgggcagatccacctggtacagcgg
cactcgccctcagaggagacgctggccttccagcgccagctcactgccctcatcggctac
gatgtcacagatgtcagcaatgtgcacgacgacgagttggagttcacacgccgccgcctg
gtcaccccgcgtatggccgaggtggctggccgcgaccccaagctctacgccatgcacccc
tgggtgacgtctaagcccctccctgagtacctgctgaagaagatcaccaacaactgtatc
ttcatcattattcaccgcagcaccaccagccagaccatcaaggtctcggctgatgatacc
cctggcaccatcctccagagcttctttaccaaaatggccaagaagaagtccctgatggat
atccccgagagccagaacgaacaggactttgtgctgcgtgtctgtggccgcgatgagtac
ctggtgggcgagacgcccatcaaaaactttcagtgggtgcggcagtgccttaagaatggt
gaagagattcacctggtgcttgacactccgccggacccagccctggatgaggtgaggaag
gaagagtggccgctggtggatgactgcactggagtcactggctaccatgagcagctaacc
atccatgggaaggaccatgagagcgtgttcactgtgtccctgtgggactgtgaccgcaag
ttcagagtcaagatcaggggcatcgatatccccgtcctgccccggaatgcagatctcacg
gtttttgtggaggcaaacatccagtatgggcagcaagtcctttgccaaagaagaaccagc
ccaaaacccttcacggaggaggtgctctggaatgtgtggcttgagttcagtatcaagatc
aaagacttacccaaaggggctctgctcaacctccagatctactgtggcaaagcaccagct
ctgtctggtaaggcctctgcagagactcccagtcccgagtccagaggcaaagctcagctt
ctctactacgtgaacttgctgctcatcgaccaccgattcctcctgcgccacggcgagtac
gtgctccacatgtggcagttatctgggaagggggaagaccaagggagcttcaatgcagac
aagctcacatctgccaccaatcccgacaaggaaaactcaatgtccatctccattctcctg
gacaactactgtcaccccatagccttgcctaagcatcagcccacccctgacccggaaggg
gaccgcgtacgagcagaaatgcccaaccaacttcggaagcaactggaggcaatcatagct
actgatccacttaaccctcttactgcggaagacaaagaattgctttggcatttcagatat
gaaagccttaaggatcccaaagcataccctaagctctttagctcagtgaaatggggacag
caagaaattgtggccaaaacatatcaattgttagccagaagggaggtctgggatcaaagt
gctttggatgttggattaacgatgcaactcctagactgcaacttttcggatgaaaacgta
agagccattgcagttcagaaactggagagcttggaagacgatgacgttctgcattacctg
ctccaattggtccaggctgtgaaatttgaaccataccatgacagtgcccttgccagattt
ctgctgaagcgtggtttaagaaacaaaagaattggtcacttcttgttttggttcttgaga
agtgagattgcccagtcgagacactatcagcagaggtttgcagtgatcctggaggcctac
ctgaggggctgtggtacggccatgctacgggacttcactcaacaagtccaagtaattgac
atgttacaaaaagtcaccattgatattaaatcactctctgccgaaaagtatgacgtcagc
tcccaagttattttccaactaaagcaaaagcttgaaatcctgcagaatttgaatctcccc
caaagctttagagttccatatgaccctggactgaaggcaggcgcactggtgattgaaaaa
tgtaaagtgatggcctctaagaaaaaacctctgtggcttgagtttaaatgtgctgaccct
acagctctatcaaatgaaacaattggaattatctttaaacacggtgatgatctgcgccaa
gacatgcttattctacagattctacgaatcatggagtccatttgggagactgaatctttg
gatctgtgcctcctgccatatggttgcatttcaactggtgacaaaataggaaaccaccag
cacgaacctggaaaataa

DBGET integrated database retrieval system