KEGG   Bos taurus (cow): 530599Help
Entry
530599            CDS       T01008                                 

Definition
(RefSeq) laminin subunit beta-2 isoform X1
  KO
K06243  laminin, beta 2
Organism
bta  Bos taurus (cow)
Pathway
bta04151  PI3K-Akt signaling pathway
bta04510  Focal adhesion
bta04512  ECM-receptor interaction
bta05145  Toxoplasmosis
bta05146  Amoebiasis
bta05165  Human papillomavirus infection
bta05200  Pathways in cancer
bta05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    530599
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    530599
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    530599
 Human Diseases
  Cancers
   05200 Pathways in cancer
    530599
   05222 Small cell lung cancer
    530599
  Infectious diseases
   05165 Human papillomavirus infection
    530599
   05146 Amoebiasis
    530599
   05145 Toxoplasmosis
    530599
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N
Motif
Other DBs
NCBI-GeneID: 530599
NCBI-ProteinID: XP_015315133
BGD-bta: BT20722
Position
22
AA seq 1335 aa AA seqDB search
MPDAGSHCPGAPAGLGPLLLALLLLLPPMVPAPRTSAQEVPDMMPPPGCSGGNCHPPTGN
LVIGRGQSLRTSSTCGLHGPELYCVVSKLQALLQDSQNCCFCDSRDGKSHGIENVVSRSD
PDGRKTWWQAESGVENVTIQLDLEGAFYFTHLIMTFKTFRPAALLLERSVDHGHSWHVFR
YFAHNCSGLFPGIPPAPGRRVSDLVCDQRYSDIEPATEGEVIFQVLDPSFLAENTNNAEI
QELLRVTNLRVNFSKLHTLGDRPLGGLRGHPFYYYALYELVIAGSCLCHGHASECRPAPG
SPPSVEGMVHGHCVCRHHTTGTHCERCQGLYQDHPWQAAEPGYPHTCQECKCHGHARSCH
FDMALYLASGNVSGGVCDACQHNTAGRHCELCQPFFHRDPLEDPRSLHSCKPCDCNPMGA
LEGGLCDAYTDTTRGLLSGQCRCKVHVWGQRCDSCRPGHYGLSLTQSEGCQPCRCNVRGR
VPSTQACDPSSGACHCKRFVSGRDCSRCLPEFWGLSSDSLGCRPCDCDFGGAYSNRCSAG
QGLCLCRPHLHGRHCQELQSGYFCATLDQATAEAEHGRSLQPADPQLPGAPWPAPRYCTP
APGTSSGWLGPRLWRQRDPDCVLQRARQARYSHQLPRTPGKPPPLHQGSGFALGRGSDFA
RVVDGAGLSLLAPTVPRALDYDIVLRYETQAPEVWQALVRVRAQSQPRSTRCARPLPSEQ
LFQATLTHARRAVVLSRPFCFEPGTRYSVTLRLWRTKEGRRPEGGTILLDSVVLLPRVGE
LPGLRSVDPGALRRLQELHEAGCLEAARVSPPQSMPEACARLACSISALLHGGGLACECH
LQGSLSTECAPLGGQCPCRPNITGRTCDRCLPGTFGLGPTGCHECRCHPEGAASAVCNST
SGQCTCWAGCAGRRCDRCLSGRWGFPRCQPCACNGHAELCHPLTGVCQDCRGATTGRHCE
RCLDGYYGDPTLGSGQRCQPCPCPGHPGSGLYHGTSCHVDSTSGRVLCLCAPGYAGPRCD
RCSPGYFGRPWPGDDPRRSPCRPCQCNNNIDPRDPAACDPHSGHCQRCLHHSHGAGCAHC
RPGFHGSALRPGGCRRCSCDPRGTSPVRCPPEAEACFCDPVSGQCPCRPHTLGRDCSRCA
PLFWNLGGPRGCEPCSCHARHTLQPGCHPVTGQCPCRAGFGGRTCSRCQDGYWGDPEQEC
RACACDPQGSISPSCDPHTGTCRCREGISGPRCQACARGSTGGFPHCTSCPPCFASWDQR
LAPLQLHLDTMVHEVAALRQGMPGWGAGLRGDQLQALEGKLQQAQTLLESPSPTRGPLQQ
FTEWITGLRQGVWGH
NT seq 4008 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatgctggctcccactgcccaggagccccagccgggctaggcccccttctctta
gccctgctgctgctgctgccacccatggtcccggctcccagaacaagtgcccaggaggta
ccagacatgatgcctcctcccggctgctcaggtggcaactgccacccacctactggcaac
ctggttattggccgtggccagagccttcgaacctcatctacctgtggcctccatggccct
gaactctactgtgttgtcagtaaactacaggcgcttctccaggactctcagaattgctgc
ttttgtgattctcgggatgggaaaagccatggcattgagaatgtggtctcccggagtgac
cctgatggcagaaagacctggtggcaagcagagagtggtgttgagaatgtcaccatccag
ttggacctagaaggtgccttttactttacccacctcatcatgacttttaagacattccgc
ccagcagctctgctccttgagcgctcagtggaccatggccactcctggcatgtgttccgc
tactttgcccacaactgctcaggcctctttcctgggatccctcctgcccctggccgcaga
gtcagtgacctcgtctgtgaccagcgttactcagacatcgagcctgccactgagggagag
gtaattttccaagttctggacccatcctttctggcggagaacacaaacaacgcggagatt
caggaactcctgcgtgtgactaacctccgtgtgaacttctccaagctgcacacactgggt
gacaggcccctggggggcctcaggggccaccccttctactactatgctctctatgagcta
gtgattgcaggcagctgcctgtgccacggccatgcttccgagtgcaggcccgcacccggg
tccccacccagcgtggaaggcatggtgcatggccattgtgtctgccgccaccacaccact
ggtacccactgtgaacgttgccagggcctgtaccaggaccacccgtggcaggcagcagag
cctgggtacccccacacctgccaggaatgcaagtgccatgggcacgcccgcagttgtcac
tttgacatggccctgtatctcgcatctggcaacgtgagtggaggtgtgtgcgatgcatgt
caacacaacacggccgggcgccactgtgagctctgccagcccttcttccaccgggacccc
ctggaggacccccgctcccttcactcctgcaaaccctgtgactgcaaccctatgggtgcc
ctggaagggggtttgtgtgatgcctacacagacaccacccggggtctcctctctgggcag
tgtcgctgcaaagttcacgtctggggccagcgctgtgactcctgccggccaggtcactat
ggcctgagcctcacccagtcagaaggctgccagccctgcaggtgcaacgtccggggccgg
gtccccagcactcaggcctgtgatccatccagcggtgcctgtcactgcaaacgctttgtc
tctggacgggactgcagccgctgtctgcctgagttctggggtctgagcagtgactctcta
ggctgtcggccctgtgactgtgactttgggggtgcctacagcaacaggtgttctgcaggg
cagggcctctgcctctgccgcccccacctgcatggccgccactgccaggaactccagtct
gggtacttctgcgccaccctcgaccaggccactgccgaagcagagcatggccgcagcctc
cagcctgctgacccccagctgcctggagccccctggcctgctccccgctactgtacacca
gccccagggacctcctctggttggctcgggccccgactttggagacagcgtgaccctgac
tgtgtcctccaacgtgccaggcaagcccggtacagccaccagctgcccaggaccccaggg
aagcccccgcccctgcatcagggatctggctttgcactggggaggggctcagacttcgca
cgtgtggtggacggggctggcctctctctgctggcacccacagtgcctcgcgccctggac
tatgacatcgtcctacgctatgagacccaggcacctgaagtgtggcaggcattagtccgg
gtccgtgcccagtcacagccccgcagtacccgctgtgcccgtccgttgccctcagagcag
ctgttccaggcgaccttgacccatgcgcgcagagccgtggttctttccagaccgttctgc
tttgaacccggaacccgctactccgtgaccctgcggctgtggcggaccaaggagggacgg
agacccgaagggggcacgatcctcctggattcagtagtgctcctgccgcgggttggagag
ttgcctggactgaggtccgtggacccgggggccctgaggcgcttgcaggagctccacgag
gcgggctgcctggaggcagcgagggtgagcccaccccaaagcatgcctgaggcctgtgcc
cgcctcgcctgcagcatctcagccctgctccatggaggtggcctcgcatgtgagtgccac
ctgcagggttcactgagcaccgagtgtgccccactgggggggcaatgcccctgccgccct
aatatcacaggtcgtacctgtgaccgctgcttgcctgggacatttggcctcgggcccacc
gggtgccatgagtgccgctgccaccccgagggggctgccagtgccgtctgtaactctacg
agtgggcagtgcacgtgttgggcaggctgtgctggtcgccgctgtgaccgttgcctctct
ggccggtggggcttcccacgctgccagccctgtgcctgcaatggacacgccgagttgtgc
cacccactcacaggcgtctgccaggactgccgcggagccaccacaggccggcattgtgag
aggtgcttggatggctactatggagaccccaccctgggctcaggccagcggtgccagccc
tgcccctgtcctgggcaccctggctcaggcctctatcatgggacctcctgccatgtggac
agcaccagtggacgtgtcctgtgcctctgtgcccccggctatgcaggaccccgctgtgac
cgctgctcccccggctactttgggcgcccctggcctggagatgaccccagaaggagtccc
tgccggccctgccagtgcaacaacaatattgatccccgtgacccagccgcctgtgacccc
cacagcggacattgccagcgctgtctgcaccacagccacggcgctggctgtgcccactgc
cggcctggcttccacggcagtgccctgcgcccagggggctgccggcgctgcagctgtgac
ccccggggcaccagccctgtaaggtgcccacctgaggctgaagcctgcttctgtgacccg
gtcagcgggcagtgcccctgccgcccccacacactggggcgggactgtagccgctgtgcc
cccctcttctggaacctcggggggccccggggctgtgagccctgcagctgccacgcccga
cacactttgcagccggggtgtcacccggtcacgggtcagtgcccctgccgggcaggattt
gggggccgcacgtgctcccggtgtcaggatgggtactggggtgacccggagcaggagtgc
agagcctgtgcctgtgacccccagggctccatctcgcccagctgtgacccgcacacaggc
acctgccgctgccgagagggtatctcagggccgaggtgccaggcgtgtgcccgtggctcc
acaggaggcttcccacactgcacgtcctgccctccctgcttcgcctcctgggaccaacgc
ctggctcccctccagctgcatctggacaccatggtccatgaggtggctgccctgcgccag
ggcatgcctggctggggtgctgggctccggggagatcagctgcaggccctggagggtaaa
ctccagcaggctcagacactcctggaatcaccttcccccaccagaggtcccctgcaacaa
tttacagagtggatcaccggactcaggcaaggggtctggggtcattag

DBGET integrated database retrieval system