KEGG   Bos taurus (cow): 531367Help
Entry
531367            CDS       T01008                                 

Gene name
NXN
Definition
(RefSeq) nucleoredoxin
  KO
K17609  nucleoredoxin [EC:1.8.1.8]
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bta01009]
    531367 (NXN)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.8  protein-disulfide reductase
     531367 (NXN)
Protein phosphatases and associated proteins [BR:bta01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Other PP2-interacting proteins
     531367 (NXN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin_8 Thioredoxin_2 AhpC-TSA Thioredoxin Thioredoxin_6 Redoxin Thioredoxin_7 SCO1-SenC Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 531367
NCBI-ProteinID: NP_001095606
BGD-bta: BT15258
Ensembl: ENSBTAG00000000855
VGNC: 32376
UniProt: A6QLU8
Position
19
AA seq 435 aa AA seqDB search
MSGFLEELLGEKLVTGGGEEVDVHSLAARGISLLGLYFGCSLSAPCAQLSASLAAFYGRL
RGDAAAGPGPGPGAGASAEPEPRRRLEIVFVSSDQDQRQWQDFVRDMPWLALPYKEKHRK
LKLWNKYRISNIPSLIFLDATSGKVVCRNGLLVIRDDPEGLEFPWGPKPFREVIAGPLLR
SNGQSLESSSLEGSHVGVYFSAHWCPPCRSLTRVLVESYRKIKEAGQKFEIIFVSADRSE
DSFKQYFSEMPWLAVPYTDEARRSRLNRLYGIQGIPTLIVLDPQGEVITRQGRVEVLNDE
DCRGFPWHPKPVLELSDSNAVQLNEGPCLVLFVDSEDDGESEAAKQLIQPIAEKIIAKYK
AKEEEAPLLFFVAGEDDMTDSLRDYTNLPEAAPLLTILDMSARAKYVMDVEEITPAIVEA
FVNDFLAEKLKPEPI
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggattcctggaggagctgctgggcgagaagctagtgactggcggcggcgaggag
gtggacgtgcactcgctggccgcccgcggcatctcgctgctcgggctctacttcggctgc
agcctgagcgccccctgcgcgcagctcagcgccagcctggccgccttctacggccgcctg
cggggggacgcagcggccgggccggggccggggccgggggccggggcgtcggcggagccc
gagccgcggcgccgcctggagatcgtcttcgtgtcctcggatcaggaccagcggcagtgg
caggacttcgtgcgggacatgccgtggctggcgctaccctacaaggaaaagcacaggaag
cttaaactttggaacaaatatcgaatttccaacattccatcgctcatattcttagacgcc
acttccgggaaggtcgtgtgcaggaacgggctgctggtgatccgcgatgacccagagggt
ttggaattcccctggggacctaaacccttcagggaagtcattgcagggcccttgcttaga
agtaacgggcagtccctggagagcagcagcctggaggggtctcacgtgggagtctatttc
tccgcacactggtgtccaccctgccgaagcctcacccgggtcctagtggagtcctaccgg
aagatcaaggaggcaggccagaaattcgagatcatctttgttagtgcggacaggtctgag
gactcattcaaacagtacttcagtgagatgccgtggcttgcagtcccctacaccgacgag
gcccggcggtcgcgcctcaaccggctgtatggaatccaaggcatccccacgctcatcgtg
ctggacccgcagggggaggtgatcacgcggcagggacgggtggaggtgctgaatgacgag
gactgcaggggcttcccgtggcaccccaagcccgtgctggagctctccgactccaacgcc
gtgcagctcaacgagggcccctgcctcgtcctgtttgtagattctgaggatgacggcgag
tcggaggcggccaagcagctgatccagccaatagctgagaagatcattgccaagtacaaa
gccaaagaggaggaggcgccgctcctgttctttgtggcgggggaggatgacatgactgac
tccctgcgagattacaccaacctgcccgaggctgcccctttactcaccattctggacatg
tcagcccgggccaagtacgtgatggacgtggaggagatcacccccgccattgtggaggcc
tttgtgaatgacttcctagcagaaaagctcaaaccagagcccatctag

DBGET integrated database retrieval system