KEGG   Bos taurus (cow): 532635Help
Entry
532635            CDS       T01008                                 

Gene name
RCOR3
Definition
(RefSeq) REST corepressor 3
Organism
bta  Bos taurus (cow)
SSDB OrthologParalogGFIT
Motif
Pfam: Myb_DNA-binding ELM2 Myb_DNA-bind_7 Myb_DNA-bind_6
Motif
Other DBs
NCBI-GeneID: 532635
NCBI-ProteinID: NP_001179662
BGD-bta: BT24787
Ensembl: ENSBTAG00000007110
VGNC: 33836
Position
16
AA seq 495 aa AA seqDB search
MRVGAEYQARIPEFDPGATKYTDKDNGGMLVWSPYHSIPDAKLDEYIAIAKEKHGYNVEQ
ALGMLFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKSFHRIQQMLPDKTI
ASLVKYYYSWKKTRSRTSLMDRQARKLANRHNQGDSDDDVEETHPVDGNDSDYDPKKEAK
KEGNTDQPVQTSKIGLGRREYQSLQHRHHSQRSKCRPPKGMYLTQEDVVAVSCSPNAANT
ILRQLDMELISLKRQVQNAKQVNSALKQKMEGGIEEFKPPESNQKINARWTTEEQLLAVQ
GVRKYGKDFQAIADVIGNKTVGQVKNFFVNYRRRFNLEEVLQEWEAEQGTQASNGDASTL
GEETKSASNVPSGKSTDEEEEAQTPQASRTLGPSPPAPSSTPTPAAPMAALNQPPPLLRP
TLPAAPALHRQPPPLQQQARFIQPRPTLNQPPPPLIRPANSMPPRLNPRPVLSAVGGQQP
PSLIGIQTDSQSSLH
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagagtcggagctgaatatcaagctcggatccccgaatttgatccaggtgctacaaag
tacacagataaagacaatggaggaatgcttgtgtggtctccatatcacagtatcccagat
gccaaattggatgaatatattgcaattgcaaaggagaaacatggctacaatgtggaacag
gcacttggcatgttgttctggcataaacataacattgagaagtcccttgctgatctccct
aatttcactccctttccggatgagtggacagtggaagataaagtcctatttgaacaagcc
tttagttttcatgggaagagctttcacaggattcagcaaatgcttccagataagacaatt
gctagccttgtgaaatattactattcctggaaaaaaactcgatctaggacaagcttaatg
gatcgccaggctcgtaaactagccaatagacataatcagggtgacagtgatgatgacgtg
gaagaaacacacccagtggatggaaacgatagtgattatgatcccaaaaaagaagccaag
aaagagggtaatactgaccagcctgtccaaactagcaagattggacttgggaggagagaa
tatcagagtttacaacaccgccatcattctcagcgttctaagtgccgtccacctaagggc
atgtatttaacccaagaagacgtggtagctgtttcctgtagccccaatgcagccaacacc
atcctgaggcaactggacatggagttgatctctttaaaacgtcaggttcagaatgctaag
caagtaaacagtgcacttaaacagaaaatggaaggtggaattgaagaattcaaacctcct
gagtcaaatcagaaaattaatgcccgttggaccacagaggagcagcttctagcagtgcaa
ggtgtccgcaaatatggtaaagattttcaagctattgcagatgtaattggcaacaagact
gttggccaagtgaagaacttctttgtaaactacaggcgtcggtttaacttagaggaggta
ttgcaggagtgggaagcagaacaaggaacccaggcttctaatggtgatgcttctacttta
ggggaggagacaaaaagtgcttctaatgtgccatcagggaagagcactgatgaagaagag
gaggcacagaccccacaggcttctcggactctgggtccatcacctcctgccccgtcatcc
actccaacgccagcagcccccatggccgctctgaaccagccaccaccacttcttcgtcca
acactgcctgcggccccggctcttcaccggcagcctcctccactccagcagcaggctcgg
ttcatccagccccggccaactttaaatcagcctccgccacctctcattcgccccgctaat
tccatgccgccccgtctaaatccaagaccagtgttgtccgcggttggtggccaacagcca
ccatcacttatcggaattcagacagattcacagtcgtcactgcactaa

DBGET integrated database retrieval system