KEGG   Bos taurus (cow): 532713Help
Entry
532713            CDS       T01008                                 

Gene name
CAMK2D
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit delta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
bta  Bos taurus (cow)
Pathway
bta04012  ErbB signaling pathway
bta04020  Calcium signaling pathway
bta04024  cAMP signaling pathway
bta04066  HIF-1 signaling pathway
bta04114  Oocyte meiosis
bta04217  Necroptosis
bta04261  Adrenergic signaling in cardiomyocytes
bta04310  Wnt signaling pathway
bta04360  Axon guidance
bta04713  Circadian entrainment
bta04720  Long-term potentiation
bta04722  Neurotrophin signaling pathway
bta04725  Cholinergic synapse
bta04728  Dopaminergic synapse
bta04740  Olfactory transduction
bta04750  Inflammatory mediator regulation of TRP channels
bta04911  Insulin secretion
bta04912  GnRH signaling pathway
bta04916  Melanogenesis
bta04921  Oxytocin signaling pathway
bta04922  Glucagon signaling pathway
bta04925  Aldosterone synthesis and secretion
bta04934  Cushing syndrome
bta04971  Gastric acid secretion
bta05031  Amphetamine addiction
bta05152  Tuberculosis
bta05200  Pathways in cancer
bta05205  Proteoglycans in cancer
bta05214  Glioma
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    532713 (CAMK2D)
   04310 Wnt signaling pathway
    532713 (CAMK2D)
   04066 HIF-1 signaling pathway
    532713 (CAMK2D)
   04020 Calcium signaling pathway
    532713 (CAMK2D)
   04024 cAMP signaling pathway
    532713 (CAMK2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    532713 (CAMK2D)
   04217 Necroptosis
    532713 (CAMK2D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    532713 (CAMK2D)
   04922 Glucagon signaling pathway
    532713 (CAMK2D)
   04912 GnRH signaling pathway
    532713 (CAMK2D)
   04921 Oxytocin signaling pathway
    532713 (CAMK2D)
   04916 Melanogenesis
    532713 (CAMK2D)
   04925 Aldosterone synthesis and secretion
    532713 (CAMK2D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    532713 (CAMK2D)
  09154 Digestive system
   04971 Gastric acid secretion
    532713 (CAMK2D)
  09156 Nervous system
   04725 Cholinergic synapse
    532713 (CAMK2D)
   04728 Dopaminergic synapse
    532713 (CAMK2D)
   04720 Long-term potentiation
    532713 (CAMK2D)
   04722 Neurotrophin signaling pathway
    532713 (CAMK2D)
  09157 Sensory system
   04740 Olfactory transduction
    532713 (CAMK2D)
   04750 Inflammatory mediator regulation of TRP channels
    532713 (CAMK2D)
  09158 Development and regeneration
   04360 Axon guidance
    532713 (CAMK2D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    532713 (CAMK2D)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    532713 (CAMK2D)
   05205 Proteoglycans in cancer
    532713 (CAMK2D)
  09162 Cancer: specific types
   05214 Glioma
    532713 (CAMK2D)
  09165 Substance dependence
   05031 Amphetamine addiction
    532713 (CAMK2D)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    532713 (CAMK2D)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    532713 (CAMK2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bta01001]
    532713 (CAMK2D)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     532713 (CAMK2D)
Protein kinases [BR:bta01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   532713 (CAMK2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr DUF4440 SnoaL_3 Pkinase_fungal Kdo SnoaL_4 SnoaL_2 PAF-AH_p_II
Motif
Other DBs
NCBI-GeneID: 532713
NCBI-ProteinID: NP_001039798
BGD-bta: BT20563
Ensembl: ENSBTAG00000014463
UniProt: Q2HJF7
Structure
PDB: 

Position
6
AA seq 488 aa AA seqDB search
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAKSLLKKPDGVKKRKSSSSVQMMESTESSNTTIEDEDVKARKQEI
IKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPI
HTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRS
GSPTVPIN
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgactacaacctgcaccaggttcacggacgagtatcagcttttcgaggagctc
ggaaagggggcattctcagtggtgagaagatgtatgaaaatccctactggacaagaatat
gctgccaaaattatcaacaccaaaaagctttctgctagggatcatcagaaactggaaagg
gaagctagaatctgccgtcttttgaagcaccccaatattgtgcgacttcatgacagcata
tcagaagagggcttccattacttggtgtttgatttagttactggcggtgaactgtttgaa
gacatagtggcaagagagtattacagtgaagctgatgccagtcattgtatacagcagatt
ctagaaagtgtaaatcattgtcacctaaatggcatagtgcacagggatctgaagcctgag
aatttgcttttagctagcaaatccaagggagcagctgtgaaactcgccgactttggctta
gccatagaagtccaaggagaccagcaggcgtggtttggttttgctggtacacctggatat
ctttctccagaagttttacgtaaagatccttatggaaagccagtggatatgtgggcatgc
ggagtcatcctctacattctactggttggatatccaccattctgggatgaagaccaacac
agactctaccagcagatcaaggctggagcttatgactttccgtcaccagagtgggacacc
gtgactcctgaagccaaagacctcatcaataaaatgcttactatcaaccctgccaagcgc
atcacggcctcagaggcactgaaacacccgtggatctgtcaacgttctactgttgcttcc
atgatgcacagacaggagactgtagactgcttgaagaaattcaatgcgagaagaaaacta
aagggtgccatcttgaccactatgctggctacgaggaatttttcagccaagagtttgttg
aagaaaccggatggagtaaagaaaaggaagtccagttcgagtgttcagatgatggagtca
actgagagctcaaatacaacaattgaggatgaagacgtgaaagcacgaaagcaagagatt
atcaaagtcactgaacaactgatcgaagctatcaacaatggggactttgaagcttacaca
aaaatctgtgacccaggccttactgcttttgaacccgaagctttgggtaatttagtggaa
gggatggactttcatcgattctactttgaaaatgctttgtccaaaagcaataaacccatc
cacaccatcatcctgaaccctcatgtgcacctggtgggcgacgatgctgcctgcatagcg
tacattaggctcacccagtacatggatggcagtggaatgccaaaaacaatgcagtcggaa
gagacacgtgtgtggcaccgccgggatggaaagtggcagaacgttcattttcatcgctcg
gggtcgccaacagtacccatcaactaa

DBGET integrated database retrieval system