KEGG   Bos taurus (cow): 533058Help
Entry
533058            CDS       T01008                                 

Gene name
GATB
Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
bta  Bos taurus (cow)
Pathway
bta00970  Aminoacyl-tRNA biosynthesis
bta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    533058 (GATB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bta03029]
    533058 (GATB)
Enzymes [BR:bta01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     533058 (GATB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     533058 (GATB)
Mitochondrial biogenesis [BR:bta03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    533058 (GATB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N
Motif
Other DBs
NCBI-GeneID: 533058
NCBI-ProteinID: NP_001039808
Ensembl: ENSBTAG00000013914
UniProt: Q2KHT5
Position
17
AA seq 399 aa AA seqDB search
MAAPMLRWCCPGRRFAFARVGCGSCHRRGPPTGSTSNGKRGQSSVAQQPHITAQKPRKGE
PEWAAVVGLEIHAQIASNSKLFSGSQVCFAAPPNSLVSFFDASLPGTLPVLNRRCVEAAV
MTGLALDCHINRKSLFDRKHYFYADLPAGYQITQQRLPIAVNGSLAYSVYVGRKPSQMVT
RTVRVKQIQLEQDSGKSLHDDLRSQTLIDLNRAGIGLLELVLEPDMSCGEEAATAVRELQ
LILQALGTSQANMAEGQLRVDANISVHRPGEPLGIRTEVKNLNSARFLAKAIDYEIQRQI
NELENGGEILNETRSFDFKLGCTVPMRDKEGKQDYRFMPAQPAPAAALRLRVPPLRRRPA
AGDQHRPAAGASPRAAPRDPPEARATVRDAARAQLRPAE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcccatgttgcgctggtgctgtcctggaaggcgttttgctttcgcccgggtt
ggctgcggttcttgtcacagaagagggcctccgactgggtccacgtccaacgggaaaaga
gggcagagctcagtggctcagcagccccacatcacagcccagaagccgagaaaaggtgaa
cctgaatgggcagctgtggtaggattggaaattcatgcccagattgcctccaactccaaa
ctcttttctggatctcaagtctgctttgcagctcctcccaattctttggtatcttttttt
gatgcatctctacctggaactttgccggtcctcaacaggcggtgcgtggaagcagccgtg
atgaccggcctagccctggactgtcacatcaacaggaagtccttgtttgaccggaagcac
tacttctatgcagacctccctgcgggctaccagattacccagcagaggctgccgatcgct
gtgaacgggagcttggcatacagcgtctatgtggggaggaagccaagtcagatggtcacc
aggaccgtgagggtgaagcagatccagctggagcaggacagtggcaaaagcctgcacgac
gacctgcggtcccagacgctcattgacctgaacagggcagggatcggccttctggaactg
gtcctggagccggacatgtcctgtggagaagaggcggccacagctgtcagggagctgcag
ctgattcttcaggccttggggaccagccaggccaacatggcagagggccagttaagagtg
gatgccaacatatctgtgcatcgccctggggagcctttgggcattcgaaccgaagtgaag
aatctcaacagtgcccgatttttggccaaagctatagactatgaaattcagaggcaaatc
aatgaacttgagaatggaggtgaaattctgaatgaaactcgctcgtttgatttcaagctt
gggtgcaccgtgccgatgagagacaaagaaggaaaacaagactacaggttcatgccagcc
caacctgcccccgctgctgctctacgactcagggtccctcccctccggcgcagacccgca
gcaggtgatcaacatcgaccagctgcgggagcgtctccccgagctgccccgcgtgacccg
ccagaggctcgtgcaacagtacgggatgctgcccgagcacagctgcgtcctgctgaatga

DBGET integrated database retrieval system