KEGG   Bos taurus (cow): 533088Help
Entry
533088            CDS       T01008                                 

Gene name
GPX2
Definition
(RefSeq) glutathione peroxidase 2
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bta  Bos taurus (cow)
Pathway
bta00480  Glutathione metabolism
bta00590  Arachidonic acid metabolism
bta01100  Metabolic pathways
bta04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    533088 (GPX2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    533088 (GPX2)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    533088 (GPX2)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     533088 (GPX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 533088
NCBI-ProteinID: NP_001156611
VGNC: 29618
Position
10
AA seq 190 aa AA seqDB search
MAYIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRR
LVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGFQPTFTLVQKCDVNGQNEHPVFAYLK
DKLPYPYDDPFSLMTDPKFIIWSPVRRSDVSWNFEKFLIGPEGEPFRRYSRTFQTINIEP
DIKRLLKVAI
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcttacattgccaagtccttctacgacctcagtgctatcagcctggatggggagaag
gtagatttcaatacattccgaggcagggcagtgctgattgagaacgtggcctcgctttga
ggcacaaccacccgggacttcacccaactcaacgagctgcaatgccgcttccccaggcgt
ctggtggttcttggcttcccttgcaatcaatttggacatcaggagaactgtcagaatgaa
gagatcttgaacagcctcaagtacgtccgccccgggggtgggttccagcccaccttcacc
cttgtccagaagtgtgatgtgaatggtcagaatgagcatcctgtctttgcctacctgaag
gataagctcccctacccttatgatgacccgttttccctcatgaccgatcccaagttcatc
atttggagccccgtgcgccgctcagatgtgtcctggaactttgagaagttcctcattggg
ccggaaggggagcccttccgccgctacagccgcaccttccaaaccatcaacatcgagcct
gacatcaagcgcctcctcaaagttgccatatag

DBGET integrated database retrieval system