KEGG   Bos taurus (cow): 533276
Entry
533276            CDS       T01008                                 

Gene name
RABGGTB
Definition
(RefSeq) geranylgeranyl transferase type-2 subunit beta
  KO
K05956  geranylgeranyl transferase type-2 subunit beta [EC:2.5.1.60]
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:bta01006]
    533276 (RABGGTB)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bta04131]
    533276 (RABGGTB)
Enzymes [BR:bta01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.60  protein geranylgeranyltransferase type II
     533276 (RABGGTB)
Prenyltransferases [BR:bta01006]
 Protein prenylation
  Rab geranylgeranyltransferase
   533276 (RABGGTB)
Membrane trafficking [BR:bta04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    533276 (RABGGTB)
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
    533276 (RABGGTB)
SSDB
Motif
Pfam: Prenyltrans SQHop_cyclase_C SQHop_cyclase_N
Other DBs
NCBI-GeneID: 533276
NCBI-ProteinID: NP_001015646
BGD-bta: BT23952
Ensembl: ENSBTAG00000018447
VGNC: 33671
UniProt: Q5E9B3
Position
3
AA seq 331 aa
MGTPQKDVIIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGIYWGLTVMDLM
GQLHRMNREEILTFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSINVIDINKVV
EYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGG
FGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVC
YSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSL
LGEEQIKPVSPVFCMPEEVLRRVNVQPELVS
NT seq 996 nt   +upstreamnt  +downstreamnt
atgggtacaccgcagaaagatgttatcattaagtcagatgcacctgacaccctgttactg
gagaagcatgctgattatattgcatcctatggctcaaagaaagatgactacgaatattgc
atgtctgaatatttgagaatgagtggcatctattggggtctgaccgtaatggatctcatg
ggacaactacatcgtatgaatagagaagaaattctgacgtttattaagtcttgtcaacac
gagtgtggtggaataagtgctagtattggacatgatcctcatcttttgtatactcttagt
gctgttcagatacttactctctatgatagtattaatgttattgacataaataaagttgtg
gaatatgttcagagtctacagaaagaagatggttcttttgctggagatatctggggagaa
attgatacaagattctctttttgtgcagtggcaactttggcactattggggaagttggat
gctattaatgtggaaaaggcaatcgaatttgttttatcatgtatgaactttgatggtgga
tttggttgcagaccaggttctgaatcccatgctgggcagatctattgttgcacaggattc
ttggctattactagtcagttgcaccaagtaaattctgatttactcggttggtggctttgt
gaacgacagcttccatcaggtggactcaatggaaggccagagaagttaccagatgtatgc
tattcatggtgggtgttggcttccctaaagataattggaaggcttcattggattgataga
gaaaaactccgcagtttcatcctagcatgtcaagatgaagaaacaggaggatttgcagat
aggccaggagatatggtagatccttttcatactctgtttggaattgctggattgtcactt
ttgggagaagaacagattaaacctgttagccctgttttttgcatgcctgaagaagtactt
cggagagtgaatgttcagcctgaactagtgagctag

DBGET integrated database retrieval system