KEGG   Bos taurus (cow): 533323
Entry
533323            CDS       T01008                                 
Symbol
PDE3B
Name
(RefSeq) cGMP-inhibited 3',5'-cyclic phosphodiesterase B
  KO
K13296  cGMP-inhibited 3',5'-cyclic phosphodiesterase B [EC:3.1.4.17]
Organism
bta  Bos taurus (cow)
Pathway
bta00230  Purine metabolism
bta01100  Metabolic pathways
bta04022  cGMP-PKG signaling pathway
bta04024  cAMP signaling pathway
bta04371  Apelin signaling pathway
bta04910  Insulin signaling pathway
bta04914  Progesterone-mediated oocyte maturation
bta04922  Glucagon signaling pathway
bta04923  Regulation of lipolysis in adipocytes
bta04924  Renin secretion
bta05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    533323 (PDE3B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    533323 (PDE3B)
   04024 cAMP signaling pathway
    533323 (PDE3B)
   04022 cGMP-PKG signaling pathway
    533323 (PDE3B)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    533323 (PDE3B)
   04922 Glucagon signaling pathway
    533323 (PDE3B)
   04923 Regulation of lipolysis in adipocytes
    533323 (PDE3B)
   04914 Progesterone-mediated oocyte maturation
    533323 (PDE3B)
   04924 Renin secretion
    533323 (PDE3B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    533323 (PDE3B)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     533323 (PDE3B)
SSDB
Motif
Pfam: PDEase_I DUF1129
Other DBs
NCBI-GeneID: 533323
NCBI-ProteinID: XP_002693091
BGD-bta: BT17078
Ensembl: ENSBTAG00000005218
VGNC: 32675
UniProt: E1BN64
Position
15:complement(37933483..38095487)
AA seq 1115 aa
MRRDERDAKAMRSPPPPDGAASPPESVRNGYVKGCVSPLRQDPPRGFFFHLCRFCNVELL
LPPPASPQQPRRGSPFSRARLLLGALAAFVLALLLGSGPESWAAGAARLRTLLSVCSQSL
SPLFSIACAFFFLTCFLTRTKRGAGPGRSGGGSWWLLALPACCYLGDFLVGQWESWSRGD
GDARAPVPHTPPAVAGRWFLVLSCVGLLTLAQPGRLRHSIVVLLFSSFVWWVSFTSLGAL
PPALRPLLSCLVGGVGCLLALGLDHFFQIREAPQQPQLSSTAEEKVPVIRPRRRSSCVSF
GETSGGYYGSCKMFRRPSLPCISREQMILWDWDLKQWYKPHYQISGGGSGVDLSVLNEAR
NMVSDLLVDPTLPPQVIASLRSISSLMGAFSGSCRPKMNPLTPFPGFYPCSEIEDPAEKG
DRKLHKGLNSRNSLPTPHLRRSSGTSGLPPIDQTSPRWERNNGKRPHQEFGILSQGCYLN
GPFSSNLLTVPKQRSSSVSLTHHVGLRRAGGLPSMNSPSHGPVSAGSPANRSPIEFPDTA
EFLTKPPVILHKSLSSTPNSPDFYQQLRNSDSNLCNSCGHQILKYDSASEPESGTDCHRE
KSGGEDNTVFSKASFNLTEAQQEVETENRDGRKLLWEGENHLKAAAQNEEQPNIEQEASQ
DLILIEDYDSLIENMSNWNFQIFELVEKMGEKSGRILSQVVYTLFQDTGLLEIFKIPTLQ
FMNYFHALENGYRDIPYHNRIHATDVLHAVWYLTTRPIPGLQEIHSDHGAGNETAINPER
IAYISSRSCSIPDESYGCLSSNIPALELMALYVAAAMHDYDHPGRTNAFLVATNAPQAVL
YNDRSVLENHHAASAWTLYLSRPEYNFLLNLDNVEFKRFRFLVIEAILATDLKKHFDFLA
EFNAKANDVNSNGIEWSNENDRLLVCQVCIKLADINGPTKVRDLHLKWTEGIVNEFYEQG
DEEANLGLPISPFMDRSSPQLAKLQESFITHIVGPLCNSYDAAGLLPGQWIESEEDDDTE
SCYEEEDAEELDTEDEEIEDNLNSKPQRRKGRRQIFCQLMHHLTENHKIWKEIIEEEEKC
KADGNKLQMENSSLPQGDEIQVIEEADEEEERQLE
NT seq 3348 nt   +upstreamnt  +downstreamnt
atgaggagggacgagcgagacgccaaagccatgcggtccccgccgccgccggacggggcc
gcctcgccccccgagagtgtgaggaacggctacgtgaagggctgcgtgagccccctgcgg
caggaccctccgcgcggcttcttcttccacctctgccgcttctgcaacgtggagctgctg
ctgccgccgcccgcctcccctcagcagccgcggcgcggctcccccttctcccgggcgcgc
ctcttgctgggcgccttggccgcctttgtcctcgccctgctgctcggctcggggcccgag
agctgggctgctggggccgcccggttgcggaccctgctgagcgtctgctcgcaaagcctc
agccccctcttcagcatcgcctgtgccttcttcttcctcacctgcttcttgacccggacc
aagcggggcgccgggccgggccggagcggcggcggctcctggtggctgctggcactcccc
gcctgctgttacctgggggacttcttggtggggcagtgggaatcctggtctcggggggac
ggagacgccagggccccggtcccgcacacacccccagcggtggcgggccggtggttcttg
gtgctgagctgcgtgggcttgttgacgctcgcgcagccggggaggctccggcacagcatc
gtggtgctgctcttctccagcttcgtctggtgggtgtccttcaccagccttggggcgctg
cctccagccctccggcccctgctgtcctgcctggtggggggcgtcggctgcctgctggcc
ctggggctggatcacttctttcaaatcagggaagctccccagcaacctcagttgtccagt
accgcagaagaaaaagtgcctgtgatcagaccccggaggaggtccagctgcgtgtcattc
ggagaaacttcaggcggttactatggcagttgcaaaatgttcaggagaccttcgttgcct
tgcatctcgagagaacagatgattctttgggattgggatttaaagcagtggtataaacct
cactatcagatttctggaggtggaagtggagttgatctttcagtgctaaatgaggctcgc
aatatggtgtcagatcttctggttgaccccacccttcctccacaagtcattgcttcccta
cggagtatcagtagcttgatgggtgctttctcaggctcctgtaggccaaagatgaatccc
ctcacaccatttcctggattttatccctgctctgagatagaggaccccgctgagaaagga
gatcgaaaacttcacaaggggctgaacagtaggaatagtttaccaaccccacatctgagg
aggagctcgggaacctcaggtctgccacctatcgaccagacttctccaaggtgggaacgc
aataatggcaaacggcctcaccaagaatttggcattttaagtcaaggatgctatctaaat
gggccttttagttcaaatctactgacagtcccgaagcaaaggtcatcatctgtatcgtta
actcaccatgtaggtctaagaagagctggtggtttaccaagcatgaattcacccagtcat
ggaccagtgtctgctggctctccagctaaccgatcacctatagaatttcctgatactgct
gaatttcttactaaaccacctgtcattttacacaaatctctgagcagtacacccaattca
ccagatttttatcagcagcttagaaattctgatagcaatttatgtaacagctgtggacat
caaatactgaaatatgattcagcatctgaaccagagtctggtacagactgccacagggaa
aagtcaggtggcgaagacaataccgttttctcaaaagcatcattcaaccttaccgaagct
caacaagaagtggaaacagagaacagagacggcagaaaattactttgggaaggtgaaaat
cacctaaaagcagcagcacagaatgaagagcaaccaaatattgaacaagaagcatcacag
gatctgattttaatagaagattatgactcattaatagaaaatatgagtaactggaatttt
caaatttttgaacttgtagaaaagatgggagagaaatcaggaaggatcctcagtcaggtt
gtgtataccttatttcaagacactggcttattggagatatttaaaattcccactctacaa
ttcatgaactactttcatgctttagaaaatggttatcgagacattccttatcacaatcgt
atacatgccacagacgtcctacatgctgtttggtatctgacaacacggcccattcctggc
ctacaggagatccacagtgatcatggagcaggaaatgaaacagcaattaaccctgagcga
attgcttacatttcgtcgaggagctgctcgattccagatgagagctatggctgtctatct
tcaaacattcctgcgctggaactgatggctctgtatgtggcagctgccatgcatgactac
gaccacccgggacggacaaatgcgttcctagtggctaccaatgcccctcaggcagtctta
tacaacgacagatctgttttggaaaatcatcatgctgcatcagcctggactctatatctt
tctcgtccagaatacaacttccttcttaatcttgacaatgtggaattcaagcgctttcgt
tttttagtcatagaagcaatccttgccacagatcttaaaaagcattttgatttccttgct
gaattcaatgccaaggccaatgatgtaaatagtaacggtatagaatggagtaatgaaaat
gatcgcctcttagtgtgccaggtgtgcatcaaactggcagatattaatggcccaaccaaa
gttcgagacttgcatttgaaatggacagaaggcattgtcaatgaattttatgagcaggga
gatgaagaagcaaatcttggtttgcccatcagtcccttcatggatcgttcttctcctcaa
ctagcaaaactccaggaatcttttatcacccacatagtgggtcccctgtgtaactcctat
gacgctgctggtctgctaccgggtcagtggatagaatcagaagaggacgatgatactgaa
agttgttatgaggaagaagatgctgaagaattagatacagaggatgaagaaatagaggac
aatctaaattctaaaccacaaagacggaaaggcagacggcaaatattttgtcagctaatg
caccatctcaccgaaaaccacaagatatggaaggaaatcatagaggaagaagagaaatgt
aaagctgatgggaataaactgcagatggagaattcttccttacctcaaggagatgagatt
caggtcattgaagaagcagatgaagaggaagagagacagctggaataa

DBGET integrated database retrieval system