KEGG   Bos taurus (cow): 533414Help
Entry
533414            CDS       T01008                                 

Gene name
RAD54B
Definition
(RefSeq) DNA repair and recombination protein RAD54B
  KO
K10877  DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
bta  Bos taurus (cow)
Pathway
bta03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    533414 (RAD54B)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     533414 (RAD54B)
DNA repair and recombination proteins [BR:bta03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Rad54 family proteins
     533414 (RAD54B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF2_N Helicase_C ResIII HDA2-3 AAA_34
Motif
Other DBs
NCBI-GeneID: 533414
NCBI-ProteinID: NP_001179884
BGD-bta: BT29402
Ensembl: ENSBTAG00000000632
UniProt: F1MSA4
Position
14
AA seq 909 aa AA seqDB search
MRRSAAPSQLQGNPFKKPKFISPARSHPSPNEEVAKLNSDIKLFEVAANKNNFLQPQNDP
RTCNFNLPTKECAKGINHGDNYREKYCLEASTKTTLDLHHTVHSAPKEITVSKGQEEKPD
SLVKYFSVVWCKASKKKHKKWEGDGVLIVKGKSFTLKDLEGKDIGRGTGYKLKELEKIEE
GQTMMIGGKEIEVMGIISPDDFNSGRCFQFGGGCSAILSSSQAAKKCFSNPFKSVCKLSS
KENKQNSFQSCKPRHDPYAPNSLVMLRPDKNHQWLFNKNCFPVVDVVIDPHLVYYLRPHQ
KEGITFLYECVMGMRVNGRCGAILADEMGLGKTLQCISLIWTLQCQGPYGGKPIVKKTLI
VTPGSLVNNWKKEFQKWLGIERIKIFTVDQDHKVEEFTKSPFYSVLIISYEMLLRSLDQI
KNVKFDLLICDEGHRLKNSTIKTTTALISLSCEKRIILTGTPVQNDLQEFFTLIDFVNPG
ILGSLSAYRKIYEEPIIISRQPSASEEERELGEQRAAELTCLTGLFILRRTQEVINQYLP
PKIENVVFCRPGALQIALYRKLLNSQAVRFCLQGLLENTSHLICIGALKKLCNHPCLLFG
SIKEKESNSTWDESEERNLYEGLMNVFPADYNPIMFTEEESGKLQVLSKLLAVIRELRPA
EKVVLVSNYTRTLDILQEVCKRHGYAYTRLDGQTPISQRQQIVDGFNSKYSSDFIFLLSS
KAGGVGLNLIGGSHLILYDIDWNPATDIQAMSRVWRDGQKHPVHIYRLLTTGTIEEKIYQ
RQISKQGLSGAVVDLSKTSDHIQFSVEELKNLFTLHESSHCVTHDLLDCECTGENHTGDS
LEKLPVSRNCQLGPHQQKSDSLKPLSMSQLKQWRHFPGDHLNLTDPFLERIRENVSFFFQ
NITNQTTAI
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atgagacgatcagcagcaccaagtcagttgcaaggaaatcccttcaaaaaaccaaagttt
atatcaccagcaagaagtcatccaagtcctaatgaagaggttgcaaaactgaattcagat
ataaagttatttgaggttgctgcaaataagaataattttctccagccacaaaatgatccc
agaacatgcaattttaatttgcctactaaagaatgtgctaaaggaattaatcatggggat
aattacagggaaaaatattgtttggaagcatctacaaagacaacattagacctccatcat
acagttcattcagcccctaaagaaataacagtgtctaagggacaagaagagaaacctgat
agcctagttaaatatttcagtgttgtttggtgtaaagcttcaaagaaaaaacacaaaaag
tgggaaggtgatggtgttcttattgtaaaaggaaagtcatttacattaaaggatttggaa
ggcaaagacattggaagaggcactggatataaactgaaagagcttgaaaagattgaagag
ggtcaaacaatgatgattggtggaaaagaaatagaagtcatgggtatcatctctccagat
gatttcaacagtggaagatgttttcagtttggaggaggatgttctgctatcttaagttct
tctcaagctgccaagaagtgtttctctaaccctttcaaaagtgtctgtaaactcagttca
aaggaaaataaacagaacagtttccaaagttgcaaaccacgccatgacccatatgcgcca
aattcccttgttatgctccgaccagataagaatcaccagtggctgttcaataagaactgt
tttcctgttgtggatgtagtgatagatcctcacctcgtatattaccttcgaccacatcag
aaagaagggatcacattcctttatgaatgtgtaatgggaatgagggtgaatggcagatgt
ggagccattcttgccgatgaaatgggtttagggaaaacactgcaatgtatttcgcttatc
tggaccctgcagtgtcagggaccctacggaggcaagccaatagtaaagaagacacttatt
gtcacacctggaagcttggtgaataattggaagaaagaattccaaaaatggttaggaatc
gaaaggatcaagatatttactgttgatcaggaccacaaagtagaagaattcacgaaatct
ccattttattctgttcttatcatcagttatgaaatgttacttcgttccctggatcaaatt
aagaatgtaaaatttgatcttctaatttgtgatgaagggcatcgtttgaagaacagtacc
attaagacaactacagccctcattagcctctcctgtgagaaaaggataattttaactggt
actccagttcagaatgatctccaagaattttttacattaattgattttgtaaatccagga
atattaggctctttgtcagcttatagaaaaatatatgaagaacccattatcatatcaaga
caaccttctgcttctgaggaagaaagggagttaggagagcaaagagcagctgaacttact
tgcctcactggactcttcatccttagaagaacccaagaagtcataaatcaatatctccct
cctaaaatagagaatgtagtcttttgccgaccaggagccctacagattgcactttataga
aaactgttaaattctcaggccgtcagattctgtcttcaaggactgttggaaaatacttct
catctaatatgtatcggagctcttaaaaagctgtgcaatcacccctgccttttgttcggc
tcaataaaggaaaaagaaagcaactcaacttgggatgagagtgaagaaagaaatctctat
gaaggcctgatgaatgtgttccctgctgattacaacccgatcatgtttactgaggaagag
tccggaaaactgcaggtgctgtcaaaactcttagccgttatccgcgaacttcgtcctgct
gaaaaagttgtgttggtatccaactatacacgaaccctggatattttacaagaagtctgc
aagcgtcatggatatgcttatacaagacttgatggacagaccccaatctctcaaaggcag
caaattgttgatggctttaatagtaaatactcttctgattttatttttttgttaagttca
aaagctggtggtgtggggcttaaccttattggaggatctcacttaatcctctatgacatt
gattggaatccagctactgatatccaggcaatgtctagagtgtggagagatggtcagaag
caccctgtacatatttacagactcctaaccacaggtaccatagaggaaaagatctatcaa
agacagatcagtaaacaaggtctttctggggcagttgtagacctatccaagacatctgat
catattcagttttcagtggaagaacttaaaaatttgttcacattgcatgaaagttcacat
tgtgttactcatgacctgcttgactgtgaatgtacaggagaaaatcatacaggtgattca
ttggaaaaactccctgtgtctagaaattgtcagcttggtccacatcaacagaagtctgat
tccctgaaacctctctccatgtcacaactgaagcaatggagacattttcctggagatcat
ttaaatcttacagatccttttcttgaaagaataagagaaaatgtatcattcttttttcaa
aatataaccaatcaaactactgctatataa

DBGET integrated database retrieval system