KEGG   Bos taurus (cow): 534067Help
Entry
534067            CDS       T01008                                 

Gene name
USP34
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 34 isoform X1
  KO
K11853  ubiquitin carboxyl-terminal hydrolase 34 [EC:3.4.19.12]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     534067 (USP34)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   534067 (USP34)
Ubiquitin system [BR:bta04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    534067 (USP34)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 DUF3517 zf-ribbon_3
Motif
Other DBs
NCBI-GeneID: 534067
NCBI-ProteinID: XP_015328985
Ensembl: ENSBTAG00000006027
VGNC: 36724
Position
11
AA seq 3579 aa AA seqDB search
MCENCADLVEVLNEISDIEGGDGLQLRKEHTLKIFAYINSWTQRQCLCCFKEYKHLEIFN
QVVCALINLVIAQVQVLRDQLCKHCTTINIDSTWQDESNQAEEPQNIERECNEGSTERQK
SIEKKSNSTRICNLTEEESSKNSDPFSLWSTDEKEKLLLCVAKIFQIQFPLYTAYKHNTH
PTIEDISTQESNILGAFCDMNDVEVPLHLLRYVCLFCGKNGLSLMKDCFEYGTPETLPFL
IAHAFITVVSNIRIWLHIPAVMQHIIPFRTYVIRYLCKLSDQELRQSAARNMADLMWSTV
KEPLDTTLCFDKESLDLAFKYFMSPTLTMRLAGLSQITNQLHTFNDVCNNESLVSDTETS
IAKELADWLISNNVVEHIFGPNLHIEIIKQCQVILNFLAAEGRLSTQHIDCIWAAAQLKH
CSRYIHDLFPSLIKNLDPVPLRHLLNLVSALEPSVHTEQTLYLASMLIKALWNNALAAKA
QLSKQSSFASLLNTNLPIGNKKEEEELRRAAPSPWSPAASPQSSDNSDTHQSGGSDIEMD
EQLINRTKHVQQRLSDTEESMQGSSDETANSGEDGSSGPGSSSGHSDGSSNEVNSSHASQ
SAGSPGSELQSEDIADIEALKEEDEDDDHGHNPPKSSCGTDLRNRKLESQAGICLGDSQG
PSERSGTNNGTGKDLVFNTESLPSVDNRIRMLDACSHSEDPEHDISGEMNAAHIAQASQE
SCITRTGDFLGEAIGNELFNCRQFIGPQHHHHHHHHHHHHHDGHMVDDMLSADDVSCSSS
QVSAKSEKNMADFDGEESGCEEELVQINSHAELTSHLQQHLPNLASIYHEHLSQGPAVHK
HQFSSNAVTDINLDNVCKKGNTLLWDIVQDDDAVNLSEGLINEAEKLLCSLVCWFTDRQI
RMRFIEGCLENLGNNRSVVISLRLLPKLFGTFQQFGSSYDTHWITMWAEKELNMMKLFFD
NLVYYIQAVREGRQKHALYSHSAEVQVRLQFLTCVFSTLGSPDHFRLSLEQVDILWHCLV
EDSECYDDALHWFLNQVRSKDQHAMGMETYKHLFLEKMPQLKPETISMTGLNLFQHLCNL
ARLATSAYDGGSNSELCGMDQFWGIALRAQSGDVSRAAIQYINSYYINGKTGLEKEQEFI
SKCMESLMIASSSLEQESHSSLTVIERGLLMLKTHLEAFRRRFAYHLRQWQIEGTGISSH
LKALSDKQSLPLRVVCQPAGLPDKMTIEMYPSDQVADLRAEVTHWYENLQKEQINQQAQL
QEFGQSSRKGEFPGGLMGPVRMISSGHELTTDYDEKALHELGFKDMQMVFVSLGAPRRER
KGEGVQLPASCLPPPQKDNIPMLLLLQEPHLTTLFDLLEMLASFKPPSGKMAVEDSESLR
CEELHLHAENLSRRVWELLMLLPTCPNMLMAFQNISDEQSNDGLNWKELLKIKSAHKLLY
ALEIIEALGKPNRRIRRESTGSYSDLYPDSDDSSEDQVENSKNSWSCKFVAAGGLQQLLE
IFNSGILEPKEQESWTVWQLDCLACLLKLICQFAVDPSDLDLAYHDVFAWSGIAESHRKR
TWPGKSRKAAGDHAKGLHIPRLTEVFLVLVQGTSLIQRLMSVAYTYDNLAPRVLKAQSDH
RSRHEVSHYSMWLLVSWAHCCSLVKSSLADSDHLQDWLKKLTLLIPETAVRHESCNGLYK
LSLSGLDGGDSINRSFLLLAASTLLKFLPDAQALKPIRIDDYEEEPMLKPGCKEYFWLLC
KLVDNIHIKDASQTTLLDLDALARHLADCIRSREILDHQDGNIEDDGLTGLLRLATSVIK
HKPPFKFSREGQEFLRDIFNLLFLLPSLKDRQQPKCKSHSSRAAAYDLLVEMVKGSVENY
RLIHNWVMAQHMQSHAPYKWDYWPHEDVRAECRFVGLTNLGATCYLASTIQQLYMIPEAR
QAVFTAKYSEDMKHKTTLLELQKMFTYLMESECKAYNPRPFCKTYTMDKQPLNTGEQKDM
TEFFTDLITKIEEMSPELKNTVKSLFGGVITNNVVSLDCEHVSQTAEEFYTVRCQVADMK
NIYESLDEVTIKDTLEGDNMYTCSHCGKKVRAEKRACFKKLPQILSFNTMRYTFNMVTMM
KEKVNTHFSFPLRLDMTPYTEDFLMGKSDRKEGFKEVSDHSKDTESYEYDLIGVTVHTGT
ADGGHYYSFIRDIVNPHAYKNNKWYLFNDAEVKPFDSAQLASECFGGEMTTKTYDSVTDK
FMDFSFEKTHSAYMLFYKRMEPEEESGKEYKFDVSSELLELESHNSFCTWSLVISFIIEP
LENSIVHSEENEWIWHDNMQFLQDKNIFEHTYFGFMWQLCSCIPSTLPDPKAVSLMTAKL
STSFVLETFIHSKEKPTMLQWIELLTKQFNNSQAACEWFLDRMADDDWWPMQILIKCPNQ
IVRQMFQRLCIHVIQRLRPVHAHLYLQPGMEDGSDDMDASVEDIGGRSCVTRFVRTLLLI
MEHGVKPHSKHLTEYFAFLYEFAKMGEEESQFLLSLQAISTMVHFYMGTKGPENPQVEVL
SEEEGEEEEEEEDILSLAEEKYRPAALEKMIALVALLVEQSRSERHLTLSQTDMAALTGG
KGFPFLFQHIRDGINIRQTCNLIFSLCRYNNRLAEHIVSMLFTSIAKLTPEAANPFFKLL
TMLMEFAGGPPGMPPFASYILQRIWEVIEYNPSQCLDWLAVQTPRNKLAHSWVLQNMENW
VERFLLAHNYPRVRTSAAYLLVSLIPSNSFRQMFRSTRSLHIPTRDLPLSPDTTVVLHQV
YNVLLGLLSRAKLYVDAAVHGTTKLVPYFSFMTYCLISKTEKLMFSTYFMDLWNLFQPKL
SEPAIATNHNKQALLSFWYNVCADCPENIRLIVQNPVVTKNIAFNYILADHDDQDVVLFN
RGMLPAYYGILRLCCEQSPAFTRQLASHQNIQWAFKNLTPHASQYPGAVEELFNLMQLFI
AQRPDMREEELEDIKQFKKTTISCYLRCLDGRSCWTTLISAFRILLESDEDRLLVVFNRG
LILMTESFNTLHMMYHEATACHVTGDLVELLSIFLSVLKSTRPYLQRKDVKQALIQWQER
IEFAHKLLTLLNSYSPPELRNACIDVLKELVLLSPHDFLHTLVPFLQHNHCTYHHSNIPM
SLGPYFPCRENIKLIGGKSNIRPPRPELNMCLLPTMVETSKGKDDVYDRMLLDYFFSYHQ
FIHLLCRVAINCEKFTETLVKLSVLVAYEGLPLHLALFPKLWTELCQTQSAMSKNCIKLL
CEDPVFAEYIKCILMDERTFLNNNIVYTFMTHFLLKVQGQVFSEANCANLISTLITNLIN
QYQNLQSDFTNRVEISKASAALNGDLRALALLLSVHTPKQLNPALIPTLQELLSKCRTCL
QQRNSLQEQEAKERKTKDDEGATPVKRRRVSSDEEHTVDSCISDLKTETREVLTPTSTSD
NETRDSSIIDPGTEQDLPSPENSSVKEYRMEVPSSFSEDTSNIRSQHAEEQSNSGRFEDC
KELNDLHCSKGSNLAEEESEFPSTSLSAVLSDLADLRSCDGQALSSQDPEVALSLSCGHS
RGLFSHMQQHDILDTLCRTIESTIHVVTRISGKGNQAAS
NT seq 10740 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgagaactgcgcagacctggtggaggtgttaaatgaaatatctgatatagaaggt
ggtgatggactgcagctcagaaaggaacatactctcaaaatatttgcttatatcaattcc
tggacacagaggcaatgtctgtgctgcttcaaagagtataagcatttggagatttttaac
caagtagtgtgtgcacttattaacttagtgattgcccaagttcaagtgctccgagatcag
ctttgtaaacattgtactactatcaacatagattccacatggcaagatgagagtaatcaa
gcggaagaaccacagaatatagaaagagaatgtaatgagggaagtacagaaagacaaaaa
tcaatagaaaaaaaatcaaactctacaagaatttgtaatctgactgaggaagaatcttca
aagaactctgatccttttagtttgtggagtacagatgagaaggaaaaactcttactgtgt
gtggcaaaaatttttcagattcagtttcccttatatactgcttacaagcataatactcat
cctactatagaggatatatcaacccaagaaagcaacattttaggggcattctgtgatatg
aatgatgtagaagtaccattgcatttgcttcgttatgtatgtttgttttgtgggaaaaat
ggcctttctcttatgaaggactgctttgaatatggaactcctgaaactttaccatttctg
atagcacatgcatttattacagttgtgtctaatattagaatatggctgcatatccctgct
gtcatgcagcacattattccttttaggacatacgttatcaggtatttatgcaagctctct
gatcaggagttaaggcagagtgcggctcgcaacatggctgacttaatgtggagcacagtg
aaagaaccattggacacgacgttgtgctttgataaagaaagcctagatcttgcatttaag
tactttatgtcacctactttgactatgaggttggctggactaagtcagataactaatcag
cttcacaccttcaatgatgtgtgcaataatgaatcattggtatcagacacagaaacgtcc
attgcaaaagaacttgcagactggcttataagcaacaatgtggtagagcatatatttgga
ccaaatttacatattgagattatcaaacagtgccaagtgattttgaattttttggcagct
gaagggcgattgagtactcagcatattgactgcatttgggctgctgcacagttgaaacac
tgtagtcgatacatacatgacttatttccttcactcatcaagaatttggatccagtacca
cttagacatcttcttaatctggtttcggctcttgagccaagtgttcataccgaacagaca
ttgtacttggcatcgatgttaatcaaagcactatggaataatgcgctagcagctaaggcc
cagctatctaaacagagttcttttgcatctttattaaacactaatcttcccattggaaat
aagaaagaggaagaagagctcagaagagctgcaccatcaccttggtcacctgcagccagt
cctcaaagcagtgataacagtgatacccatcaaagtggaggcagtgacattgaaatggat
gagcaacttattaatagaaccaaacatgtgcaacagcgactttcagatacagaggaatcc
atgcagggaagttctgatgaaactgccaacagtggtgaagatggaagtagtggtcctggt
agcagcagtggacatagtgatggatctagcaatgaggtgaattctagccatgcaagccag
tcagcagggagccctggcagtgagttacagtcagaagacattgcagatattgaagccctg
aaagaagaagatgaagatgatgatcatggtcataatcctcctaaaagcagttgtggtacg
gatcttcggaacaggaagttagaaagtcaagcaggcatttgcttaggggattcccaaggc
ccatcagaaagaagtgggacaaacaatggaacaggaaaggacctggtttttaatactgag
tcattgccatcggtagataatagaatacgaatgctagatgcctgttcacactctgaagac
ccagaacatgatatttcgggggaaatgaatgctgctcatatagcacaagcatctcaggaa
tcttgtattacacgcactggggactttcttggggaggctattgggaatgaattatttaat
tgtcggcagtttataggtccacagcatcaccaccaccaccaccaccaccaccaccaccac
catgatggtcatatggttgatgatatgctcagtgcagatgatgtcagttgtagtagctcc
caggtcagtgcaaaatcagaaaaaaatatggctgattttgatggtgaagaatctgggtgt
gaagaggagctagttcagattaattcacatgcagagctaacatctcatctccaacaacat
cttcccaatttagcgtctatttaccatgaacatcttagtcaaggacctgcagttcataaa
catcaattcagcagtaatgctgtgacagacattaatttggataacgtttgcaagaaagga
aacactttgttgtgggatatagtccaggatgacgatgcagttaatctttctgaaggatta
ataaatgaagcagagaaacttctctgttccttagtatgttggtttacagatagacagatt
cgaatgagattcatcgaaggttgccttgaaaatttaggaaacaacagatcagtagtaatt
tcacttcgtcttcttccaaaactctttggtacctttcagcagtttgggagcagttatgat
acacattggattacaatgtgggcagaaaaagaactgaacatgatgaagcttttctttgat
aatttggtatactatattcaagctgtaagagaaggcagacaaaagcatgcattgtacagc
catagtgccgaagttcaggtgcgacttcagttcttaacttgtgtcttttccactctggga
tcacctgatcatttcaggttaagtttggagcaagttgatattttatggcattgtttagta
gaagattctgagtgttacgatgatgcactccattggtttttaaatcaagttcgaagtaaa
gatcaacatgctatgggaatggaaacctacaaacatcttttcctggagaagatgccccag
ctaaaacctgaaacaattagcatgactggcttaaacctgtttcagcatctctgtaacttg
gctcgactggctaccagtgcctatgatggtggttcaaactctgagctttgtggtatggac
caattttggggcattgctttaagagcacaatctggtgatgtcagtcgagcagctatccag
tatattaactcctattatattaatggtaaaacgggtttggagaaggagcaagaatttatt
agtaagtgtatggagagtcttatgatagcttctagcagtcttgaacaggaatcacactca
agtctcactgttatagaaagaggacttcttatgctgaagacacatctggaagcatttagg
agaaggtttgcatatcatctcagacagtggcaaattgaaggcacgggcattagtagtcat
ttgaaagcactgagtgacaaacagtccctgccgctaagggttgtttgccagccagctgga
cttcctgataagatgactattgaaatgtatcctagtgaccaggtagcagatcttagggct
gaagtaactcattggtatgaaaatttacagaaagaacaaataaatcaacaagctcagctt
caggagtttggtcaaagcagccgaaaaggagagtttcctggaggccttatgggacctgtc
aggatgatttcttctggacatgaattaacaacagattatgatgaaaaagcacttcatgag
cttggttttaaggatatgcagatggtattcgtatctctgggtgcaccaaggagagaacgg
aaaggggaaggtgttcagctgccagcatcttgcctaccaccccctcaaaaggacaacatt
ccaatgcttttgctcttacaagaacctcatttaactactctttttgatttattagagatg
ctcgcatcatttaaaccaccctcaggaaaaatggcagtcgaagatagtgagagcttaaga
tgtgaagaacttcatcttcacgcagaaaacctttccaggcgtgtatgggagctactgatg
cttcttcctacatgtcctaacatgttgatggcattccagaatatctcagatgaacagagc
aatgatggacttaattggaaagaactgctcaaaattaaaagtgctcacaagctgttatat
gccctggaaattattgaagcactgggaaaacctaacagaagaataaggagagagtcaacg
ggaagttatagtgatctctatccagattcagatgattcaagtgaggatcaagtggaaaac
agtaaaaattcctggagttgcaagtttgttgctgctggaggacttcaacagttgttagaa
atttttaattctggaattctagagccaaaagagcaggaatcctggactgtgtggcagcta
gactgtcttgcttgcttgctgaagttaatatgccagtttgcagtagatccatctgatttg
gatttagcttatcatgatgtctttgcctggtctggtatagcagaaagccataggaaaaga
acatggcctggcaaatcaagaaaggctgctggtgatcatgctaagggtcttcatatacca
agattaacagaggtatttcttgttcttgtccaaggaaccagtttgattcagcgacttatg
tctgttgcttatacatatgataatctggctcctagagttttgaaagctcaatctgatcac
aggtctagacatgaagtttcacattattctatgtggctcttggtgagttgggctcattgc
tgttctttagtgaaatctagccttgctgatagtgatcatttacaagattggctaaagaaa
ttgactctccttattcctgagactgcagtccgtcatgagtcttgcaatggtctttataag
ttatctctatcagggctggatggaggagactcaatcaatcgctcttttctgctactggct
gcctcaacattgttgaagttccttccagatgctcaagcactcaaacctatcagaatagat
gattatgaagaagaaccaatgttaaaacctggatgtaaagaatatttttggttgttgtgc
aaattagttgacaacatacatataaaggatgctagtcagacaacactgcttgacctggat
gctttggcacggcatttggctgactgtattcgaagcagggagatcctcgatcatcaagat
ggtaatatagaagatgatgggcttacaggactcctaaggcttgcaacaagtgttattaaa
cacaaaccaccctttaaattttcaagggaaggacaggaatttttaagagatatcttcaat
ctcctgtttttgttgcctagtctaaaagatagacaacagccaaagtgcaaatcacattct
tcaagagctgctgcttatgacttgttagtggagatggtaaagggatctgttgaaaactac
agattaatacataactgggtcatggcacaacacatgcagtctcacgcaccttataaatgg
gactactggcctcatgaagatgtccgtgctgagtgtagatttgttggcctgactaacctc
ggagctacttgttacttggcttctactattcagcaactttatatgatacctgaggcaaga
caggctgttttcactgctaagtattccgaagatatgaagcataagaccactcttctggag
cttcaaaaaatgtttacctatttaatggagagtgaatgcaaggcatataatcctagacct
ttctgtaaaacatacacgatggataagcagcctttgaacactggggagcagaaagatatg
acagagttttttactgatctgattactaaaattgaagaaatgtctccagaactgaaaaat
actgtcaaaagtttgtttggaggtgtaattacaaacaatgttgtgtccttggattgtgaa
catgttagtcagactgctgaagagttttatactgtgaggtgccaggtggctgatatgaag
aatatttatgaatctcttgatgaagttaccattaaagatactttagaaggtgacaacatg
tatacttgttctcattgtgggaagaaagtacgagctgaaaaaagagcatgttttaagaaa
ttgcctcagattctgagtttcaatactatgaggtatacatttaatatggtcacaatgatg
aaagaaaaagtgaatacacacttttccttcccattacgtttggatatgacaccctataca
gaagatttccttatgggaaagagtgacaggaaagaaggttttaaggaagtcagtgatcat
tcaaaagacacggagagctatgagtatgacttgataggagtgactgttcatacaggaacc
gcagatggtggacactattacagcttcattagagatatagtcaacccacatgcttataaa
aacaataaatggtatctttttaatgatgctgaggtaaaaccttttgattctgctcaactt
gcctctgaatgttttggtggagagatgacgaccaagacctatgattctgttacagataag
tttatggatttctcctttgaaaagacccacagtgcatatatgctgttttacaaacgcatg
gaaccagaggaagaaagtggcaaagagtacaaatttgatgtttcatccgaattgctagag
ctggagtctcataacagcttctgcacttggtctcttgtgatttcattcatcattgagcct
ctggaaaactccattgtacactcagaagagaatgagtggatttggcatgataacatgcag
tttcttcaagacaaaaacatttttgaacatacatattttgggtttatgtggcagttgtgt
agttgtattcccagtacattaccagatcctaaagctgtgtctttaatgacagcaaagtta
agcacttcgtttgtcctagagacctttattcattcaaaagaaaagcccacaatgcttcag
tggattgaactgttgaccaagcaatttaataatagtcaagcagcttgtgagtggtttttg
gaccgcatggctgatgatgattggtggccaatgcagatactaattaagtgccctaatcaa
attgtgagacagatgtttcagcgtttgtgtatccatgtaattcagagacttagacctgtg
cacgctcatctctatctacaaccagggatggaagatgggtctgatgatatggatgcttca
gtagaagatataggtggtcgttcgtgtgtcactcgatttgtgagaactctgttattaatt
atggaacacggtgtaaagcctcacagtaaacatcttacagaatattttgctttcctttat
gaatttgccaaaatgggtgaagaagagagccagtttttgctttcattgcaagccatatct
acaatggtacatttttacatgggaaccaaagggcctgaaaatcctcaagttgaagtgttg
tcagaggaagaaggagaagaggaggaggaggaggaagatatactctctctggcagaagag
aaatacaggccagctgcccttgaaaaaatgatagctttagttgctcttttggttgaacag
tctcgctcagaaaggcatttgacactgtcacagactgacatggcggcattaacaggagga
aagggatttcccttcttgtttcaacatattcgtgatggcatcaatataagacaaacttgt
aatctgattttcagcctttgtcgatacaataatcgacttgcagaacatattgtatctatg
cttttcacatcaatagcaaaattgactcctgaggcagccaatcctttctttaaattgttg
actatgctaatggagtttgctggtggacctccaggaatgcctccctttgcatcttacatt
ctgcagaggatatgggaggtgattgaatacaatccttctcagtgtctggattggttggca
gtgcagacaccccgaaacaaactggcacacagctgggttctacagaatatggaaaactgg
gttgagcggtttcttttggctcacaattatcctagagtcaggacttctgcagcttatctt
ctggtgtcccttataccaagcaattcattccgccagatgttccggtcaacaaggtctttg
cacatcccaacccgtgaccttccactcagtccagacacaacagtagtcctacatcaggtc
tacaacgtgctccttggtttgctctcaagagccaaactttatgttgatgctgctgttcat
ggcactacaaagctagtgccctattttagctttatgacttactgtttaatttccaaaact
gagaagctgatgttttccacatatttcatggatttgtggaaccttttccagcctaaactt
tctgagccagcaatagctacaaatcacaataaacaggctttgctttcgttttggtacaat
gtgtgtgctgactgtccagagaatatccgccttattgttcagaacccagtggtaaccaag
aacattgccttcaattacatccttgctgaccatgatgatcaggatgtggtgctttttaac
cgtgggatgctgcctgcctactatggcattctgaggctctgctgtgagcagtctcctgca
tttacacgacaactggcttctcaccagaacattcagtgggcctttaagaatcttacacca
catgccagccaataccctggagcagtagaagaattatttaacctgatgcaactgttcata
gctcagaggccagatatgagagaagaagaattagaagatattaaacagtttaagaaaaca
accataagttgttacttacgttgcttagatggccggtcctgctggactactttaataagt
gccttcagaatactattagaatctgatgaagacagacttcttgttgtatttaatcgaggg
ttaatcctgatgactgagtctttcaacacactgcacatgatgtatcatgaagccacagct
tgccatgtgactggagacttagtagaacttctgtcaatattcctttcagttttgaagtct
acacgcccatatcttcagagaaaagacgtgaagcaagcgttaatccagtggcaggagcga
attgaatttgcccataaactgttaactcttcttaattcctatagccctccagaacttaga
aatgcctgtatagatgtcctcaaggaacttgtgcttttgagtccccatgactttcttcat
actctggttccatttctacagcacaaccattgtacttatcatcacagtaatataccaatg
tctcttggaccttatttcccttgtcgagaaaatatcaagctaataggagggaaaagcaat
attcggcctccgcgccctgaactcaatatgtgcctcttgcccacaatggtggaaaccagt
aagggcaaagatgacgtttatgatcgtatgctgctagactacttcttttcttatcatcaa
ttcatccatctattatgccgagttgcaatcaactgtgaaaaatttactgaaacattagtt
aagctgagtgtcctagttgcctatgaaggtttgccacttcatcttgcactgttccccaaa
ctttggactgagctatgccagactcagtctgctatgtcaaaaaactgcatcaagcttttg
tgtgaagatcctgtttttgcagaatatataaaatgcatcttaatggatgaaagaactttt
ctaaacaacaacattgtctacacattcatgacacattttcttctaaaggttcaaggtcaa
gtgttttctgaagctaactgtgccaatttgatcagcacccttattacaaacttgataaat
caatatcagaacctgcagtctgatttcaccaacagagttgaaatttccaaagcaagtgct
gctttaaatggggacttacgggcacttgctttgctcctgtcggtacatactcccaaacaa
ttaaacccggctctaattccaactctgcaagagcttttaagcaaatgcaggacttgtctg
cagcagagaaactcactccaagagcaagaagccaaagaaagaaaaactaaagatgatgaa
ggggcaactcctgttaaaaggcggcgcgttagcagcgatgaggagcacactgtcgacagc
tgcatcagtgacctgaagacagaaaccagggaggtcctgaccccaactagcacttcagac
aatgagacgagagactcctcaattatcgacccaggcaccgagcaagatcttccttcccct
gaaaatagttctgttaaagaataccgaatggaagttccatcttcgttttcagaagacaca
tcaaatatcaggtcacagcatgcagaagaacagtccaacagtggtaggtttgaagactgt
aaggaattgaacgacctccactgttccaagggttctaaccttgctgaggaggaatccgag
ttcccttccacttctctctctgcagttctgtctgacttagctgacttgagaagctgtgac
ggtcaagctttgtcctcccaggaccctgaggtggctttatcactcagctgtggccattcc
agaggactctttagtcacatgcagcagcacgacattctagataccctgtgtaggaccatt
gaatctacaatccatgtggtcacgaggatatctggcaaaggaaaccaagctgcttcttga

DBGET integrated database retrieval system