KEGG   Bos taurus (cow): 534069Help
Entry
534069            CDS       T01008                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 precursor
  KO
K13376  transforming growth factor beta-2
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04060  Cytokine-cytokine receptor interaction
bta04068  FoxO signaling pathway
bta04110  Cell cycle
bta04218  Cellular senescence
bta04350  TGF-beta signaling pathway
bta04380  Osteoclast differentiation
bta04390  Hippo signaling pathway
bta04933  AGE-RAGE signaling pathway in diabetic complications
bta05140  Leishmaniasis
bta05142  Chagas disease (American trypanosomiasis)
bta05144  Malaria
bta05145  Toxoplasmosis
bta05146  Amoebiasis
bta05152  Tuberculosis
bta05161  Hepatitis B
bta05166  Human T-cell leukemia virus 1 infection
bta05200  Pathways in cancer
bta05205  Proteoglycans in cancer
bta05206  MicroRNAs in cancer
bta05210  Colorectal cancer
bta05211  Renal cell carcinoma
bta05212  Pancreatic cancer
bta05220  Chronic myeloid leukemia
bta05225  Hepatocellular carcinoma
bta05226  Gastric cancer
bta05321  Inflammatory bowel disease (IBD)
bta05323  Rheumatoid arthritis
bta05410  Hypertrophic cardiomyopathy (HCM)
bta05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    534069 (TGFB2)
   04350 TGF-beta signaling pathway
    534069 (TGFB2)
   04390 Hippo signaling pathway
    534069 (TGFB2)
   04068 FoxO signaling pathway
    534069 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    534069 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    534069 (TGFB2)
   04218 Cellular senescence
    534069 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    534069 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    534069 (TGFB2)
   05206 MicroRNAs in cancer
    534069 (TGFB2)
   05205 Proteoglycans in cancer
    534069 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    534069 (TGFB2)
   05212 Pancreatic cancer
    534069 (TGFB2)
   05225 Hepatocellular carcinoma
    534069 (TGFB2)
   05226 Gastric cancer
    534069 (TGFB2)
   05220 Chronic myeloid leukemia
    534069 (TGFB2)
   05211 Renal cell carcinoma
    534069 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    534069 (TGFB2)
   05321 Inflammatory bowel disease (IBD)
    534069 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    534069 (TGFB2)
   05414 Dilated cardiomyopathy (DCM)
    534069 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    534069 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    534069 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    534069 (TGFB2)
   05161 Hepatitis B
    534069 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    534069 (TGFB2)
   05144 Malaria
    534069 (TGFB2)
   05145 Toxoplasmosis
    534069 (TGFB2)
   05140 Leishmaniasis
    534069 (TGFB2)
   05142 Chagas disease (American trypanosomiasis)
    534069 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bta04052]
    534069 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:bta00536]
    534069 (TGFB2)
Cytokines and growth factors [BR:bta04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   534069 (TGFB2)
Glycosaminoglycan binding proteins [BR:bta00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   534069 (TGFB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Motif
Other DBs
NCBI-GeneID: 534069
NCBI-ProteinID: NP_001106723
Ensembl: ENSBTAG00000005359
VGNC: 35802
UniProt: P21214
Position
16
AA seq 414 aa AA seqDB search
MHYCVLSAFLLLHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPSFLPSENAIPP
TFYRPYFRIVRFDVSSMEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSP
TQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKSPHLLLMLLPSYRLESQQSNRRK
KRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQH
SRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcgtttctgctcctgcatctggtcacggtcgcgctcagc
ctgtctacctgcagcacgctcgacatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaccagccccccagaagactaccccgaaccc
gaggaggtccccccggaggtgatctccatctacaacagcaccagggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagcggagcgacgaggaatactacgcc
aaggaggtttacaaaatagacatgccgtccttcttaccctcggaaaatgccatcccgccc
actttctacagaccgtactttagaattgtccgatttgacgtctcctcgatggagaagaat
gcttccaatttggtgaaggccgagttcagagtctttcgtttacagaacccaaaagccaga
gtgcctgaacaacggatcgagctgtatcagattctcaaatccaaagatttaacatctcca
acccagcgctacattgacagcaaagtcgtgaaaaccagagcagagggtgaatggctctcc
tttgacgtcactgatgctgttcacgaatggctccaccataaagacaggaacctgggattt
aaaataagtttacactgtccctgctgcacctttgtaccatcgaataattacatcatcccc
aataaaagtgaagaactagaagcacgctttgcaggtattgatggcacctctacctatacc
agtggtgatcagaaaacaataaagtccactaggaaaaaaaacagtgggaagagcccacat
ctcctgctaatgttgttgccctcctacagacttgagtcccaacagtccaaccggcggaag
aagcgcgctctggatgcagcctattgctttagaaatgtgcaggataattgttgcctacgc
ccactttacattgatttcaagagggatcttgggtggaaatggattcatgagcctaaaggg
tacaatgccaacttctgtgctggagcatgcccatatctgtggagctcagacactcagcac
agtagggttctcagcttatataataccataaatccagaagcgtctgcttccccttgctgc
gtgtcccaagatttagagccgctcaccattctctactacattggcaaaacacccaagatc
gaacagctttctaatatgattgtcaagtcttgcaaatgcagctaa

DBGET integrated database retrieval system