KEGG   Bos taurus (cow): 534247Help
Entry
534247            CDS       T01008                                 

Gene name
HLCS
Definition
(RefSeq) biotin--protein ligase isoform X1
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
bta  Bos taurus (cow)
Pathway
bta00780  Biotin metabolism
bta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    534247 (HLCS)
Enzymes [BR:bta01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     534247 (HLCS)
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     534247 (HLCS)
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     534247 (HLCS)
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     534247 (HLCS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_LplA_LipB BPL_N BPL_C
Motif
Other DBs
NCBI-GeneID: 534247
NCBI-ProteinID: XP_005202184
VGNC: 50274
Position
1
AA seq 872 aa AA seqDB search
MLITLCYLYLWARWGRGPAALVRATVQRLRASRCSFTFCSAAAPPRGSRVCLSRGGRVFC
VGESQSIDDLNKWALFLVSPFILEAEHIAFVTESIWVQGENLQTPASSSETIVKWSDCCL
PLACRPGDPYQLIAKASVDDFSKLGVAFLEDRLQMANGLIPQKIVSVHLQDSALKELKGQ
ASDLPAQLLQPDPESCIERNPPEPDTMEDPQSPGSVSTRGPGGAPGGSEPAMDGDRGVGS
IEHCPLHLSSCHECLELENSTIESVRFASAENIPDLPYDYSSGLEGLDDDLRPERDERRV
NVMGKAPNILLYVGSDSRDGQDRLQQVRSALADCVDTDCYTLYHLPPENALRDPWPDNCL
LLVIATGEPVPEDLSRRFMAYLSQGGKVLALASSFTLPGFRVTSKSPLQDTVQSLVFCKA
DGSLLRLSILSSGCVYEEGPGEPLDPSKLHGHLDSEDGDRLVVQVPFGIHGGEAVLCQVH
LELPPSSPVVQTQEDFNLLKSSNFRRYEVLTEILTTLGLSCDAKQAPALTPLYLLTATEE
IWGPLVQWLGKHVDPEGVIRSSKVSLKFISSYTSEIEITPSAIPVVTDTESCSSENFDFE
IYRQNLKTKKLGKVILFAEVTPTTMNLLDGLMFEMPQEMGLIAIAVRQTQGKGRGKNAWL
SPLGCALSTLLVCIPLRSALGQRIPFVQHLMSLAVVEAVRSIPGYQDINLRVKWPNDIYY
SDLMKLGGVLVNSTLMGETFYILIGCGFNVTNSNPTICINDLITEYNKEHGAQLQPLRAD
CLIARTVTVLEKLIDVFQDQGPNGVLPLYYKYWVHSAQQVCLGSAEGPQAWIAGLDDSGF
LLVHQEDGDVVTVHPDGNSFDMLRNLIVPKQQ
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atgctcatcacgctgtgctacctgtacctgtgggcgcgctgggggcgcgggccggccgcg
ctcgtgcgcgccacggtgcagcggctgcgcgcctcgcgctgctccttcaccttctgcagc
gcggccgcaccgccccggggctcccgcgtgtgccttagccgtggcggccgggtcttctgt
gtcggcgagagccagtccattgatgacttaaacaaatgggccctgttcctggtatctcct
tttatacttgaagcagagcacatcgcctttgtgacagagagcatttgggtgcaaggtgag
aatttacagacaccggcatcctcttcggaaactattgtgaagtggtctgactgctgtttg
ccgttagcttgccgacctggggatccttatcaattaatcgccaaagcaagtgtggatgac
ttcagcaagctaggggtggcattcctggaagatagactccagatggctaatggactgata
ccccagaagatcgtgtctgtccacttgcaggactctgccctaaaggaacttaagggtcag
gcctcagacctgccagcccagctcctgcagcctgaccctgaatcttgtattgagaggaac
cctcctgagcccgacactatggaggacccccagtctcctggttctgtatccacaaggggg
ccaggcggggcccctgggggcagtgagccagccatggacggtgacagaggcgtgggctcc
attgagcactgtcccctccatctgtccagctgccatgagtgtttggagcttgagaacagc
accattgaatccgtcaggtttgcctctgcagagaacattccagatctcccgtacgactac
agcagcggtttggagggcctcgacgatgacctccgccccgagagggatgagaggagggtc
aatgtcatgggcaaggcccccaacatcctcctttacgtgggctctgactctcgggatggc
caggacaggctccagcaggtccgatctgccctggccgactgtgtggacacggactgttac
actctgtaccacctgcctccagaaaacgctctcagggacccgtggccagacaactgtctg
ctgctggtcatcgccaccggggagcccgtccccgaggacctgtcccggaggttcatggcc
tatctttctcagggagggaaggtgctggccctggcgtcgtccttcacgctgcctggcttc
cgggtgaccagcaagtccccgctgcaggacacggtccagagcttggttttctgcaaggca
gacgggagcctgctgaggctcagcatcctgagcagtggctgcgtttatgaggaggggccc
ggggagccgctcgaccccagcaagctccacggccacctggacagtgaggatggggacagg
cttgtggtgcaagtgcctttcgggattcacggaggagaagctgttctttgccaggtgcac
ttggaactacctcccagctctccagtagtgcaaacacaagaggattttaacctgcttaaa
tcaagcaactttagaagatacgaagtccttacggagatcctgacgacgctgggcctaagc
tgcgacgcaaagcaagctcctgccttaacgcctctttacctgctgacggcgaccgaggaa
atctggggtcctcttgtgcagtggctggggaaacatgtggatcctgaaggagtaataaga
tccagcaaagtctccctgaaattcatttcatcctacacatctgaaatagaaatcacccca
tccgccatacccgtggtgactgacacagagtcctgctcatcagaaaactttgacttcgag
atttaccgacaaaacctgaagacaaagaagcttgggaaagtcattctgtttgccgaagta
acgcccaccacaatgaatcttctggacgggttgatgtttgagatgccgcaggaaatgggt
ttaatagccatcgcagtccgccagacgcagggcaaagggcggggaaagaatgcttggctg
agccccttgggatgcgccctttccaccctgctggtctgcatcccactgagatccgcgctg
ggacagaggattccgtttgtccagcatctgatgtccctggccgtcgtagaggcggtaaga
tccatccccgggtaccaggacatcaatttgcgagtgaagtggcccaatgatatttattac
agtgacctcatgaagcttggtggagttttggttaactcaacacttatgggagaaacattc
tatatacttattggctgtggatttaacgtgacgaacagcaaccctaccatatgcatcaat
gatctcatcacagaatacaataaggaacatggggcacagctacagcccctgagagccgac
tgtctcatcgcccgaacggtgaccgtgctggagaagctgattgacgtgtttcaggaccag
gggcccaacggcgttcttcctctctactataagtactgggtacacagcgctcagcaagtc
tgcctgggaagcgctgagggaccacaggcgtggatagctggcctggatgactccgggttc
cttctggtccaccaggaagacggtgatgtggtcacggtgcatcccgacggcaactccttc
gacatgctgagaaacctcatcgtccccaaacagcagtag

DBGET integrated database retrieval system