KEGG   Bos taurus (cow): 534280Help
Entry
534280            CDS       T01008                                 

Gene name
RARA
Definition
(RefSeq) retinoic acid receptor alpha
  KO
K08527  retinoic acid receptor alpha
Organism
bta  Bos taurus (cow)
Pathway
bta04659  Th17 cell differentiation
bta04915  Estrogen signaling pathway
bta05200  Pathways in cancer
bta05202  Transcriptional misregulation in cancer
bta05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    534280 (RARA)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    534280 (RARA)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    534280 (RARA)
   05202 Transcriptional misregulation in cancer
    534280 (RARA)
  09162 Cancers: Specific types
   05221 Acute myeloid leukemia
    534280 (RARA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bta03000]
    534280 (RARA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:bta03310]
    534280 (RARA)
Transcription factors [BR:bta03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    534280 (RARA)
Nuclear receptors [BR:bta03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   534280 (RARA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 534280
NCBI-ProteinID: NP_001014942
BGD-bta: BT16928
Ensembl: ENSBTAG00000012500
VGNC: 33729
UniProt: F1MWQ3
Position
19
AA seq 462 aa AA seqDB search
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTL
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV
EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALK
VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL
DTLSGQAGSGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaacagcagctcctgcccaacacctgggggagggcacctcaatgggtacccg
gtgcccccctacgccttcttcttcccccccatgctgggtggactctccccgccaggcgct
ctgaccactctccagcaccagcttccagtgagcggctatagcacgccatccccagccacc
attgagacccagagcagcagttctgaagagattgtgcccagccccccctcgccacctccc
ctcccccgcatctacaagccttgctttgtctgtcaagacaaatcctccggctaccactat
ggggtcagcgcctgtgaaggctgcaagggcttcttccgccgcagcatccagaagaacatg
gtgtacacgtgtcaccgggacaagaactgcatcatcaacaaggtgacccggaaccgttgc
cagtactgccggctgcagaagtgcttcgaagtgggcatgtccaaggagtctgtgagaaat
gaccggaacaagaagaagaaggaggtgcccaagcccgagtgctccgagagctacacgttg
acgccggaggtgggggagctcatcgagaaggtgcgcaaagcgcatcaggagaccttccct
gctctctgccaactgggcaaatacactacgaacaacagctcagaacagcgtgtctctctg
gacattgacctctgggacaagttcagtgaactctccaccaagtgcatcattaagactgtg
gagttcgccaagcaactgcccggcttcaccaccctcaccattgcggaccagatcaccctc
cttaaggctgcctgcctggatatcctgatcctgcggatctgcacgcggtacacgcccgag
caggacacaatgactttctcggatgggctgaccctgaaccggacccagatgcacaacgcc
ggctttggcccgctcacagacctggtcttcgccttcgccaaccagctgctgcccctggag
atggatgacgctgagactgggttgctcagcgccatctgcctcatctgtggagaccggcag
gacctggagcagccagatagggtggacatgctgcaggagccgctgcttgaggcactgaag
gtctatgtgcggaaacggaggcccagccgtccacacatgttccccaagatgctgatgaag
atcacagacctgcggagcatcagtgctaagggggctgagcgggtgatcacgctgaagatg
gagattccgggctccatgccacctctcatccaggaaatgctggagaactcagagggcctg
gacactctgagcggacaagcggggagtggggggcgggacgggggcggcctggctcccccg
cccggcagctgtagccccagcctcagccccagctcaaacagaagcagcccggccacccac
tccccgtga

DBGET integrated database retrieval system