KEGG   Bos taurus (cow): 535072Help
Entry
535072            CDS       T01008                                 

Gene name
ANAPC7
Definition
(RefSeq) anaphase-promoting complex subunit 7
  KO
K03354  anaphase-promoting complex subunit 7
Organism
bta  Bos taurus (cow)
Pathway
bta04110  Cell cycle
bta04114  Oocyte meiosis
bta04120  Ubiquitin mediated proteolysis
bta04914  Progesterone-mediated oocyte maturation
bta05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:bta00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    535072 (ANAPC7)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    535072 (ANAPC7)
   04114 Oocyte meiosis
    535072 (ANAPC7)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    535072 (ANAPC7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    535072 (ANAPC7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bta04121]
    535072 (ANAPC7)
   03036 Chromosome and associated proteins [BR:bta03036]
    535072 (ANAPC7)
Ubiquitin system [BR:bta04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     535072 (ANAPC7)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    535072 (ANAPC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_2 TPR_14 TPR_8 TPR_1 TPR_16 TPR_19 ANAPC3 TPR_7 TPR_11 TPR_12 TPR_17 ChAPs TPR_21 TPR_10 BTAD
Motif
Other DBs
NCBI-GeneID: 535072
NCBI-ProteinID: NP_001179774
BGD-bta: BT25785
UniProt: E1BM34
Position
17
AA seq 598 aa AA seqDB search
MDPGEAAILDSSPRSFSRLFALPPPLSAAFLGRMNVIDHVRDMAAAGLHSNVRLLSSLLL
TMSNNNPELFSPSQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALSKTSKVRPSTG
NSASTPQSQCLPSEIEVKYKMAECYTMLKQDKDAIAILDGIPSRQRTPKINMMLANLYKK
AGQERPSVTSYKEVLRQCPLALDAILGLLSLSVKGAEVASMTMNVIQTVPNLDWLSVWIK
AYAFVHVGDNSRAINTICSLEKKSLLRDNVDLLGSLADLYFRAGDNKNSVLKFEQAQMLD
PYLIKGMDVYGYLLAREGRLEDVENLGCRLFNISDQHAEPWVVSGCHSFYSKRYSRALYL
GAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAIRLAPCRLDCYEGLIECYLASN
SIREAMVMANNVYKTLGANAQTLTLLATVCLEDPVTQEKAKTLLDKALTQRPDYIKAVVK
KAELLSREQKYEDGIALLRNALANQSDCVLHRILGDFLVAVNEYQEAMDQYSIALSLDPN
DQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDSEAAQWADQEQWFGMQ
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggacccgggtgaggccgccattttggactcttccccaaggagcttcagccggcttttc
gcgctgccgccgccgctgtctgcggccttcctgggcagaatgaatgtgatagaccatgtg
cgagacatggcggccgcggggctgcactccaacgtgcggctcctcagcagcttgttactt
acaatgagtaataacaaccctgagttattctccccatctcagaagtaccagcttttggtg
tatcatgcagattctctctttcatgataaggagtatcggaatgctgtgagtaagtatact
atggctttacagcagaagaaagccctaagtaaaacttcaaaagtgagaccttcaactgga
aattctgcatccactccacagagtcagtgtcttccatctgaaattgaagtaaaatacaaa
atggctgaatgttacacaatgctaaaacaagataaagatgccatcgctatacttgatggg
atcccttcaagacaaagaactcccaaaataaacatgatgttggcaaacctgtacaagaag
gctggtcaggagcgaccttccgtcaccagctataaggaagtgctgaggcagtgcccatta
gcccttgatgcgattctaggtttgctgtctctttctgtaaaaggtgcagaggtggcatca
atgacgatgaatgtgatccagactgtgcctaacttggattggctttctgtgtggatcaaa
gcctatgcttttgtgcatgttggtgacaattcgagagcaatcaataccatttgttcacta
gagaaaaagtccttgttgagagataacgtggacctactgggaagcttagcagatctgtac
ttcagagctggagacaataagaactctgtcctcaagtttgaacaggcacagatgttggat
ccatatctaataaaaggaatggatgtgtatggctatctcctggcacgagaagggcggctg
gaggatgtggagaaccttggctgccgcctttttaatatatctgaccaacatgcagaaccg
tgggtggtctctgggtgtcatagcttctatagcaaacgctattctcgagccctctattta
ggagccaaggcaattcagctgaacagtaacagtgttcaagctttgctacttaagggagca
gcgcttagaaacatgggcagagtccaggaagcaataatccactttcgggaggctatacgt
cttgcgccttgtcgcttagattgttatgaaggtctcatcgaatgttacttagcctccaac
agtattcgtgaagcaatggtaatggctaacaatgtttacaaaactctaggagcaaatgca
cagacccttacccttttagccaccgtttgtcttgaagacccagtgacacaggagaaagcc
aaaaccttattagataaagccctgacccaaaggccggattacattaaggctgtggtgaaa
aaagcagaactacttagcagagaacagaaatatgaagatggaattgctttgttgaggaac
gcactggctaatcagagtgactgtgtcctgcatcggatcctaggagatttccttgtagct
gtcaatgagtatcaggaagcaatggaccagtatagtatagcactaagtttggaccccaat
gaccagaagtctctagaggggatgcagaagatggagaaggaggagagtcccacggatgcc
actcaggaggaggatgtggacgacatggaagggagtggggaagaaggggacctggagggc
agcgacagtgaggcggcccagtgggctgaccaggagcagtggttcggcatgcagtga

DBGET integrated database retrieval system