KEGG   Bos taurus (cow): 535321
Entry
535321            CDS       T01008                                 

Gene name
PPP2R1A
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
bta  Bos taurus (cow)
Pathway
bta03015  mRNA surveillance pathway
bta04071  Sphingolipid signaling pathway
bta04114  Oocyte meiosis
bta04151  PI3K-Akt signaling pathway
bta04152  AMPK signaling pathway
bta04261  Adrenergic signaling in cardiomyocytes
bta04350  TGF-beta signaling pathway
bta04390  Hippo signaling pathway
bta04530  Tight junction
bta04728  Dopaminergic synapse
bta04730  Long-term depression
bta05142  Chagas disease
bta05160  Hepatitis C
bta05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:bta00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    535321 (PPP2R1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    535321 (PPP2R1A)
   04390 Hippo signaling pathway
    535321 (PPP2R1A)
   04071 Sphingolipid signaling pathway
    535321 (PPP2R1A)
   04151 PI3K-Akt signaling pathway
    535321 (PPP2R1A)
   04152 AMPK signaling pathway
    535321 (PPP2R1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    535321 (PPP2R1A)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    535321 (PPP2R1A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    535321 (PPP2R1A)
  09156 Nervous system
   04728 Dopaminergic synapse
    535321 (PPP2R1A)
   04730 Long-term depression
    535321 (PPP2R1A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    535321 (PPP2R1A)
   05165 Human papillomavirus infection
    535321 (PPP2R1A)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    535321 (PPP2R1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bta01009]
    535321 (PPP2R1A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bta03019]
    535321 (PPP2R1A)
   03036 Chromosome and associated proteins [BR:bta03036]
    535321 (PPP2R1A)
Protein phosphatases and associated proteins [BR:bta01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     535321 (PPP2R1A)
Messenger RNA biogenesis [BR:bta03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     535321 (PPP2R1A)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     535321 (PPP2R1A)
SSDB
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Cnd1 Adaptin_N CLASP_N TAF6_C M11L
Other DBs
NCBI-GeneID: 535321
NCBI-ProteinID: NP_001032554
BGD-bta: BT24237
Ensembl: ENSBTAG00000019851
VGNC: 33253
UniProt: Q32PI5
Position
18
AA seq 589 aa
MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIY
DEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHS
PSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPM
VRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDL
EALVMPTLRQAAEDKSWRVRYMVADKFTELHKAVGPEITKTDLVPAFQNLMKDCEAEVRA
AASHKVKEFCENLSADCRENVIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGKDS
TIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHA
TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNV
AKSLQKIGPILDNSTLQSEVKPVLEKLTQDQDVDVKYFAQEALTVLSLA
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggcggcggccgatggcgacgactcgctctaccccatcgcggtgctcatagacgagctc
cgcaacgaggatgttcagcttcgcctcaacagcatcaagaagctctccaccattgccttg
gccctcggggtcgaaaggacccgcagtgagcttctgcccttccttacagacaccatctac
gatgaggacgaggtcctcctggccctggcggagcagctgggcaccttcaccactctggtc
ggaggccccgagtacgtgcactgcctgctgccgcccctggagtcgctggccacggtggag
gagacggtggtgcgggataaggcagtggagtccctgcgggccatctcgcacgagcactcc
ccctccgaccttgaggcccactttgtgcccctggtgaagcggctggcgggcggcgactgg
ttcacctcccgcacctcagcctgcggcctcttctccgtctgctacccccgcgtgtccagt
gccgtcaaggcggagcttcgacagtacttccggaacctgtgctcagatgatacccccatg
gtgcggcgggccgcagcctccaagctgggggagtttgccaaggtgctggagctggacaat
gtcaagagcgagatcatccccatgttctccaacctggcctctgacgagcaggactcggtg
cggctgctagcggtggaggcatgcgtgaacatcgcccagctcctgccccaggaggacctg
gaggccctggtgatgcccaccctgcgccaggctgctgaggacaagtcctggcgcgtccgt
tacatggtggccgacaagttcacggagctccataaagcggtggggcctgagatcaccaag
acggacctggtccctgccttccaaaacctgatgaaagactgtgaggccgaggtgagggcc
gccgcctcccacaaggtcaaagaattctgtgaaaatctctccgctgactgtcgggagaat
gtgatcatgacccagatcttgccctgcatcaaggagctggtgtctgacgccaaccagcac
gtcaagtcggcgctggcctccgtcatcatgggcctctccccgatcctgggcaaagacagc
accatcgagcacctcctgcccctcttcctggcccagctgaaggatgagtgcccggaggtg
cggctgaacatcatctccaacctggactgcgtgaacgaggtgatcggcatccggcaactg
tcgcagtccctgctccctgccatcgtggagctggcggaggatgccaagtggcgggtgcgg
ctggccatcatcgagtatatgcctctgctggcgggacagctgggggtggagttctttgat
gagaaactcaactccttgtgcatggcctggcttgtggatcatgtctatgccatccgcgag
gcagccaccagcaacctgaagaagctggtggagaaattcggaaaggagtgggcccatgcg
actatcatccccaaggtcttggccatgtctggggaccccaactacctgcaccgcatgacc
acactcttctgtatcaatgtgctgtccgaggtttgcgggcaggacatcaccaccaagcac
atgctgcccaccgtgctgcgcatggccggggaccctgtcgccaacgtccgcttcaatgtg
gccaagtccctgcagaagatcgggcccatcctggacaacagcacgctgcagagtgaggtc
aagcccgtcctcgagaagctgacccaggaccaggacgtggatgtcaagtacttcgcccag
gaggctctgactgttctgtctctcgcctga

DBGET integrated database retrieval system