KEGG   Bos taurus (cow): 535416
Entry
535416            CDS       T01008                                 

Gene name
SIRT6
Definition
(RefSeq) NAD-dependent protein deacetylase sirtuin-6
  KO
K11416  NAD+-dependent protein deacetylase sirtuin 6 [EC:2.3.1.286]
Organism
bta  Bos taurus (cow)
Pathway
bta00760  Nicotinate and nicotinamide metabolism
bta01100  Metabolic pathways
bta04714  Thermogenesis
bta05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    535416 (SIRT6)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    535416 (SIRT6)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    535416 (SIRT6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bta03036]
    535416 (SIRT6)
Enzymes [BR:bta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.286  protein acetyllysine N-acetyltransferase
     535416 (SIRT6)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     535416 (SIRT6)
SSDB
Motif
Pfam: SIR2 TPP_enzyme_M
Other DBs
NCBI-GeneID: 535416
NCBI-ProteinID: NP_001091553
BGD-bta: BT19067
Ensembl: ENSBTAG00000019909
VGNC: 34635
UniProt: A5D7K6
Position
7
AA seq 359 aa
MSVNYAAGLSPYADKGKCGLPEVFDPPEELEQKVWELAQLIWQSSSVVFHTGAGISTASG
IPDFRGPHGVWTMEERGLAPTFDTTFENAQPTKTHMALVQLERVGLLHFLVSQNVDGLHV
RSGFPRDKLAELHGNMFIEECVKCKMQYVRDTVVGSMGLKPTGRLCTVAKSRGLRACRGE
LRDTILDWEDSLPDRDLTLADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVN
LQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPHMVERALPPLPRPPAPKLEPK
EEASPQLNSPVPANPKQEPTAEPCTQHNGSGPTSPKRERPDSPSPHRPPKRVKTEVVPS
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgtcggtgaattacgcggcggggctttcgccgtatgcagacaagggcaagtgcggtcta
cccgaggtcttcgacccccccgaggagttggagcagaaggtgtgggagctggcacagctc
atctggcagtcctccagtgtggtgttccacacaggcgcaggcatcagcactgcctcaggc
atccccgacttcaggggcccccatggcgtctggacgatggaggagcggggcctggccccc
acgttcgacaccaccttcgagaacgcccagcccacaaagacccacatggcgctggtccag
ctggagcgtgtgggcctcctgcacttcctggtcagccagaacgtggacggactgcacgtg
cgctccggcttccccagagacaagctggcagagctccacggaaacatgtttatagaagaa
tgtgtcaagtgtaagatgcagtatgtccgggacaccgtggtgggcagcatgggcctgaaa
cccacgggccggctctgcaccgtggccaagtccagggggctgcgggcctgcaggggggag
ctgagagataccatcctggattgggaggattccctgcctgaccgggacctcaccttggcc
gacgaagccagcaggaatgcagacctgtccatcacactgggcacctccctgcaaatccgg
cccagcgggaaccttcccctcgccaccaagcgacgtggaggtcgcctggtcatcgtcaac
cttcagcccaccaagcacgaccgccacgcagacctgcgaatccacggttatgttgatgag
gtcatgacgcggctcatgaaacacctgggcctggagatcccggcctgggacggcccccac
atggtggagagggcactgccgcccctgccacgcccacctgcccccaagctggagcccaag
gaggaggcctccccccagctcaacagcccagtgcctgccaaccccaagcaggaacccaca
gctgagccctgcacccagcacaatggttctggacccaccagccccaaaagggagcggccg
gacagcccttcccctcacaggcctcccaaaagagtgaaaaccgaggtggtgcctagctga

DBGET integrated database retrieval system