KEGG   Bos taurus (cow): 535530
Entry
535530            CDS       T01008                                 

Gene name
FOXO3
Definition
(RefSeq) forkhead box protein O3
  KO
K09408  forkhead box protein O3
Organism
bta  Bos taurus (cow)
Pathway
bta01521  EGFR tyrosine kinase inhibitor resistance
bta04062  Chemokine signaling pathway
bta04068  FoxO signaling pathway
bta04137  Mitophagy - animal
bta04151  PI3K-Akt signaling pathway
bta04152  AMPK signaling pathway
bta04211  Longevity regulating pathway
bta04213  Longevity regulating pathway - multiple species
bta04218  Cellular senescence
bta04722  Neurotrophin signaling pathway
bta04917  Prolactin signaling pathway
bta05213  Endometrial cancer
bta05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    535530 (FOXO3)
   04151 PI3K-Akt signaling pathway
    535530 (FOXO3)
   04152 AMPK signaling pathway
    535530 (FOXO3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    535530 (FOXO3)
  09143 Cell growth and death
   04218 Cellular senescence
    535530 (FOXO3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    535530 (FOXO3)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    535530 (FOXO3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    535530 (FOXO3)
  09149 Aging
   04211 Longevity regulating pathway
    535530 (FOXO3)
   04213 Longevity regulating pathway - multiple species
    535530 (FOXO3)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    535530 (FOXO3)
   05223 Non-small cell lung cancer
    535530 (FOXO3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    535530 (FOXO3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bta03000]
    535530 (FOXO3)
Transcription factors [BR:bta03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    535530 (FOXO3)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 535530
NCBI-ProteinID: NP_001193012
BGD-bta: BT12225
Ensembl: ENSBTAG00000011234
VGNC: 29099
UniProt: F1N4K5
Position
9
AA seq 672 aa
MAEAPASPAPISPLEVELDPEFEPQSRPRSCTWPLQRPELQGSPAKPSGEAAADSMIPEE
EDDEDDEDGGGRAGSAMAIGGGGGGPLGSGLLLEDSARLLAPGGQDPGSGPAPAAGALSG
GTQTPLQPQQPLPPPQPGTAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLS
QIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGG
KSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSSD
ELDAWTDFRSRTNSNASTVSGRLSPILASTELDDVQDDDAPLSPMLYSSSASLSPSVSKP
CTVELPRLTDMAGTMNLNDGLADNLMDDLLDNIALPASQPSPPGGLMQRSSSFPYTTKGS
GLGSPTSSFSSAVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLSH
SDVMMTQSDPLMSQASTAVSAQNSRRNVMLRSDPMMSFAAQPNQGSLVNQNLLHHQHQTQ
GALGGSRALSNSVSNMGLSDSSSLGSAKHQQQSPVSQSMQTLSDSVSGSSLYSTSANLPV
MGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGSFTG
AKQASSQSWVPG
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggcagaggcgccggcctccccggccccgatctctccgctcgaagtggagctagacccg
gagttcgagccccagagccggccgcgctcctgtacgtggcccctgcagaggccggagctc
caggggagcccggccaagccctctggggaggcggctgctgactccatgatccccgaggag
gaggacgatgaagacgacgaggacggtggcggtagggccggctcggccatggcgatcggc
ggcggcgggggcggcccgctgggctctgggttgctcctggaggactcggcccggctgctg
gctcctggagggcaggaccccgggtccgggccagcccccgcggcgggcgcgctgagcggg
gggacgcagacaccgctgcagcctcagcagccactgccaccgccgcagccggggacggct
gggggctctgggcagccgaggaaatgctcgtcgcggaggaacgcctgggggaacctgtcc
tacgccgatctgatcactcgcgcgatcgagagctctccagacaaacggctcactctgtcc
cagatctatgagtggatggtgcgctgcgtgccctacttcaaggataagggcgacagcaac
agctctgccggctggaagaactctatccggcacaacctgtcactgcacagccggttcatg
cgggtccagaatgagggaaccggcaagagctcgtggtggatcatcaaccctgacggcggg
aagagtggcaaggcgccccggcggcgggccgtctccatggacaacagcaacaagtacacc
aagagccgcggccgtgcagccaagaagaaggcagccctgcagaccgcccccgagtcagca
gatgacagtccctcccagctctccaagtggcccggcagccccacatcccgcagcagcgat
gagctggacgcgtggaccgacttccgctcgcgcaccaattccaacgccagcacagtcagc
ggccgcctgtcccccatcctggcgagcacggagctggacgacgtccaggacgatgatgca
ccactgtcccccatgctctatagcagctcggccagcctgtcgccctccgtcagcaagccg
tgcactgtggagctgccccggctgaccgacatggcgggcaccatgaatctgaacgacggg
ctggccgacaacctcatggacgacctgctggacaatatcgcgctccctgcatcccagcca
tcgcccccgggggggctcatgcagcgcagctccagcttcccgtacaccaccaagggctcc
ggcctgggctcccccaccagctccttcagcagcgcggtatttggtccctcgtctctgaac
tccctgcgccagtctcccatgcagaccatccaagagaacaagccagccaccttctcttcc
atgtcccactacggcaaccagacactccaggacctgctcacatcggactcactcagccac
agcgatgtcatgatgacccagtcggaccccttgatgtctcaggccagcaccgctgtgtcc
gcccagaactcccgccggaacgtgatgcttcgcagtgacccaatgatgtcctttgccgcc
cagcctaaccaggggagtttggtcaatcagaacttgctccaccaccagcaccaaacccag
ggcgctctcggtggcagccgtgccttgtcgaattccgtcagcaacatgggcttgagcgac
tccagcagcctcgggtcagccaaacaccagcaacagtctcccgtcagccagtctatgcaa
accctctcggactctgtctcaggctcctccttgtactcaaccagtgcgaaccttccagtc
atgggtcacgagaagttccccagcgacttggacctggacatgttcaatgggagcttggaa
tgtgacatggagtccattatccgtagcgaactcatggatgctgatgggttggattttaac
tttgattccctcatctccacacagaacgttgttggtttgaacgtggggagcttcactggt
gctaagcaggcctcatctcagagctgggtgccaggctga

DBGET integrated database retrieval system