KEGG   Bos taurus (cow): 535742Help
Entry
535742            CDS       T01008                                 

Gene name
SRC
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
bta  Bos taurus (cow)
Pathway
bta01521  EGFR tyrosine kinase inhibitor resistance
bta01522  Endocrine resistance
bta04012  ErbB signaling pathway
bta04015  Rap1 signaling pathway
bta04062  Chemokine signaling pathway
bta04137  Mitophagy - animal
bta04144  Endocytosis
bta04360  Axon guidance
bta04370  VEGF signaling pathway
bta04510  Focal adhesion
bta04520  Adherens junction
bta04530  Tight junction
bta04540  Gap junction
bta04611  Platelet activation
bta04625  C-type lectin receptor signaling pathway
bta04727  GABAergic synapse
bta04750  Inflammatory mediator regulation of TRP channels
bta04810  Regulation of actin cytoskeleton
bta04912  GnRH signaling pathway
bta04915  Estrogen signaling pathway
bta04917  Prolactin signaling pathway
bta04919  Thyroid hormone signaling pathway
bta04921  Oxytocin signaling pathway
bta04926  Relaxin signaling pathway
bta05100  Bacterial invasion of epithelial cells
bta05135  Yersinia infection
bta05152  Tuberculosis
bta05161  Hepatitis B
bta05163  Human cytomegalovirus infection
bta05167  Kaposi sarcoma-associated herpesvirus infection
bta05168  Herpes simplex virus 1 infection
bta05203  Viral carcinogenesis
bta05205  Proteoglycans in cancer
bta05219  Bladder cancer
bta05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    535742 (SRC)
   04012 ErbB signaling pathway
    535742 (SRC)
   04370 VEGF signaling pathway
    535742 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    535742 (SRC)
   04137 Mitophagy - animal
    535742 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    535742 (SRC)
   04520 Adherens junction
    535742 (SRC)
   04530 Tight junction
    535742 (SRC)
   04540 Gap junction
    535742 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    535742 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    535742 (SRC)
   04625 C-type lectin receptor signaling pathway
    535742 (SRC)
   04062 Chemokine signaling pathway
    535742 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    535742 (SRC)
   04915 Estrogen signaling pathway
    535742 (SRC)
   04917 Prolactin signaling pathway
    535742 (SRC)
   04921 Oxytocin signaling pathway
    535742 (SRC)
   04926 Relaxin signaling pathway
    535742 (SRC)
   04919 Thyroid hormone signaling pathway
    535742 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    535742 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    535742 (SRC)
  09158 Development and regeneration
   04360 Axon guidance
    535742 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    535742 (SRC)
   05203 Viral carcinogenesis
    535742 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    535742 (SRC)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    535742 (SRC)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    535742 (SRC)
   05152 Tuberculosis
    535742 (SRC)
   05100 Bacterial invasion of epithelial cells
    535742 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    535742 (SRC)
   05168 Herpes simplex virus 1 infection
    535742 (SRC)
   05163 Human cytomegalovirus infection
    535742 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    535742 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    535742 (SRC)
   01522 Endocrine resistance
    535742 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bta01001]
    535742 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bta04131]
    535742 (SRC)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     535742 (SRC)
Protein kinases [BR:bta01001]
 Non-receptor tyrosine kinases
  SRC family
   535742 (SRC)
Membrane trafficking [BR:bta04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    535742 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    535742 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    535742 (SRC)
  Macropinocytosis
   Kinases
    535742 (SRC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase SH3_10 SH3_3 hSH3
Motif
Other DBs
NCBI-GeneID: 535742
NCBI-ProteinID: NP_001104274
BGD-bta: BT11155
Ensembl: ENSBTAG00000008938
VGNC: 35269
Position
13
AA seq 542 aa AA seqDB search
MGSNKSKPKDASQRRRSLESAENTHGGGGGGGGGGGAFPSSQTPSKPASSDGHRGPNTAF
APAAAEPKLFGGFNSSDTVTSPQRAGPLSGGVTTFVALYDYESRTETDLSFKKGERLQIV
NNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGT
FLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYS
KHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTR
VAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLK
GETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGESLVCKVADFGLARLI
EDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREV
LDQVERGYRMPCPPECPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEPQYQPGE
NL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggatgccagccagcggcgccgcagcctggagtct
gctgagaacacccacggaggcggcggcggcggcggcggcggtgggggtgccttcccctcc
tcgcagacccccagcaagccagcctcctctgatggccaccgcggccccaacacggccttc
gcccctgcagccgctgagcccaagctgttcggaggcttcaactcctcggacacagtcacc
tccccgcagagggcggggcccctgtctggcggagtgaccaccttcgtggccctctatgac
tatgagtcgcggacagagactgacctgtctttcaagaaaggggagcggcttcagattgtc
aacaacacagagggagactggtggctggcccactcgctcagcacaggacagacgggctac
atccccagcaactacgtggcaccctctgactccatccaggctgaagagtggtactttggc
aagatcaccagacgggagtcagagcggttactgctcaatgcagagaacccaagagggacc
ttcctagtgcgagaaagcgagaccacgaaaggcgcctactgcctctcggtgtctgacttc
gacaacgccaagggcctcaacgtgaagcactacaaaatccgcaagctggacagcggaggc
ttctacatcacctcccgcacccagttcaacagcctgcagcagctggtggcctactactcc
aaacacgctgacggcctctgccaccgcctcaccactgtgtgccccacgtccaagccgcag
actcaaggcttggccaaagatgcctgggagatcccccgggagtcgctgcggctggaggtc
aagctgggccagggctgcttcggagaggtgtggatgggtacctggaacggcaccaccagg
gtggccatcaaaaccctgaagcctggtacgatgtctccggaggccttcctgcaggaggcc
caggttatgaagaaactgaggcatgaaaaactcgtgcagctgtacgccgtggtgtccgaa
gagcccatctacattgtcacggagtacatgagcaaggggagtttgctggactttctcaag
ggggagacaggcaagtacctgcggctgcctcagctggtggacatggctgcacagatcgcc
tcaggcatggcttatgtggaacggatgaactatgtccaccgagacctccgggctgccaac
atcctggttggagagagcctcgtatgcaaagtggctgacttcgggctggctcgactcatt
gaagacaacgaatacacagcccggcaaggtgccaaattccccatcaagtggacagctccg
gaagctgccctctatggccggttcaccatcaaatcagacgtgtggtcctttgggatcctg
ctgacggagctcacaacaaagggacgggtgccctaccctgggatggtgaaccgggaggtg
ctggaccaggtggagcggggctaccggatgccctgccctcctgagtgtcccgagtcattg
catgacctgatgtgccagtgctggcggaaggacccggaggaacggcccaccttcgagtac
ctgcaggccttcctggaggactatttcacgtccaccgagccccagtaccagcccggagag
aacctatag

DBGET integrated database retrieval system