KEGG   Bos taurus (cow): 536093Help
Entry
536093            CDS       T01008                                 

Gene name
DHX8
Definition
(RefSeq) ATP-dependent RNA helicase DHX8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
bta  Bos taurus (cow)
Pathway
bta03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:bta00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    536093 (DHX8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bta03041]
    536093 (DHX8)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     536093 (DHX8)
Spliceosome [BR:bta03041]
 Complex C
  Other components
   Step II factors
    536093 (DHX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 S1 Helicase_C DEAD AAA_22 T2SSE AAA_19 Flavi_DEAD AAA_30 AAA_16 PhoH ABC_tran Sigma54_activ_2
Motif
Other DBs
NCBI-GeneID: 536093
NCBI-ProteinID: NP_001193020
BGD-bta: BT23630
Ensembl: ENSBTAG00000008339
VGNC: 28059
Position
19
AA seq 1218 aa AA seqDB search
MAVAVAMAGAVPGTELGPAEELAKLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKN
TTFDTFKASLVKNGAEFTDSLISNLLRLIQTMRPPAKPSTSKDPVVKPKTEKEKLKELFP
VLCQPDNPSVRTMLDEDDVKVAVDVLKELEALMPSAAGQEKHRDTEHRDKAKKKKRSRSR
ERDRDRERERERDRDHKRRHRSRSRSRSRTRDRNKGKSRYRSRSRSQSPPRDRKDRDKYG
DRNLDRWRDKHVDRPPPEEPAIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRR
EGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEET
SMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKWEIKQMIAANVLSKEEFPDFDEE
TGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQSAL
AKERRELKQAQREAEMDSIPMGLNKHWVDPLPDAEGRQIAANMRGIGMMPNDIPEWKKHA
FGGNKASYGKKTQMSIIEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYL
AEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMT
DGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDA
VKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTG
QEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIA
ETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRL
YTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLY
TLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPK
DKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQM
LGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALF
NRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLY
NRYEEPNAWRISRAFRRR
NT seq 3657 nt NT seq  +upstreamnt  +downstreamnt
atggccgtggctgtggccatggcgggagccgtacccgggacagagctaggccccgcagaa
gaactcgccaaactcgagtatctgtctttggtgtcaaaggtttgcaccgagctggataat
cacttaggtatcaacgacaaggatttggctgaatttgtgatcagtcttgctgagaaaaat
accacctttgatactttcaaggcttcgctggtcaaaaatggtgcagaattcacggattca
ctcattagtaacttgctgcgtctcatacaaaccatgcggcctccagcaaagccttctacc
agcaaagatccagttgttaagcccaaaactgaaaaagaaaagctgaaggaactcttccca
gtcctttgccagccagacaacccttctgttcggaccatgctggacgaggatgacgtgaaa
gtcgctgtggatgtcctgaaagaactggaggccttgatgcccagtgcagcaggccaggag
aagcacagagacaccgagcaccgggacaaggccaagaaaaagaagcgcagccggagccga
gagcgagaccgtgaccgcgagcgagaacgagaacgtgatagagaccataagcggagacac
cggtcccgctctcgatcgcgttcccggacccgggacaggaataaggggaagtctagatac
cggtccaggagcagaagtcagagtccccccagagatcggaaagaccgagacaagtatggg
gatcggaatctggacagatggagagataagcacgtggaccgccctcccccagaagagccc
gccatcggggacatttacaacggcaaggtcaccagcattatgcagtttggatgttttgtg
cagctggagggactgaggaagcggtgggaaggcctggtgcacatctctgagctccggcgg
gaaggccgtgtggccaatgtggctgacgtggtgagcaaaggccagagggtcaaggtcaaa
gtgctgtccttcactgggaccaaaaccagcttgagcatgaaggatgtggatcaagagact
ggagaagatctaaacccaaatcgacggcggaatcttgtcggggagaccaacgaggagacc
tctatgaggaatccggacaggcccacccacctgtccctcgtcagtgcccctgaagtagag
gatgactcactagagcgcaagcgccttactcgaatctctgacccagagaagtgggagata
aagcagatgattgctgccaatgtcctttccaaggaagagttcccagacttcgatgaagag
actggcattctccctaaagtggatgatgaagaagatgaggaccttgagattgagctggtt
gaggaagagcctccattcctgagagggcacaccaaacaaagcatggacatgagccctatc
aaaatcgttaagaatccagatggctccctctcccaagcagcaatgatgcagagtgccttg
gccaaagaaaggcgggaacttaagcaagcacagcgggaagctgagatggattctattccc
atgggactcaacaaacattgggttgatcctctgcctgatgcggaaggcagacagattgct
gccaacatgaggggtattgggatgatgcccaatgacattcccgagtggaagaagcatgcc
tttgggggcaacaaagcttcatatggaaaaaagacccagatgtcaatcattgaacaaagg
gagagcctccccatctacaagctgaaggagcagctggtccaggctgtccatgacaaccag
atcctgattgttattggagagactgggtctgggaagaccacgcagatcacccagtacctg
gcggaggcgggctacacttccaggggcaagattggatgtacccagcctagaagagtagcg
gccatgtctgtggccaaaagagtgtcagaggagttcggttgttgcttaggccaagaggtg
ggctacaccattcgatttgaggactgcaccagccccgaaacagtcatcaagtacatgaca
gatgggatgttgctccgagaatgcctgatcgaccccgacctcactcagtatgcaatcatc
atgttggacgaggcgcacgagagaacaattcacactgatgtgctctttggattgctgaaa
aagacggttcagaaacggcaggacatgaaactgattgtcacctcagccacgttggatgct
gtgaagttttctcagtacttctatgaagctcccatctttaccatcccaggtcgaacatac
ccagtggaaatattgtacacaaaggaacctgaaaccgattatctagatgctagcttgatc
acggtcatgcagatccacttaacagaaccaccaggtgatatcctggtcttcctgactggt
caggaagagatcgatactgcttgcgagatcctgtatgaaagaatgaaatccctgggacct
gatgttccagagctgattatcctcccagtgtactctgctctccccagtgagatgcagacc
cgaatctttgacccagctccacctggcagcagaaaggtcgtgattgccaccaacattgcg
gagacatcgctgactattgatggcatttactatgtggtggaccctggattcgtgaagcag
aaggtgtacaattctaagacagggattgaccagctcgtggtgactcctatttctcaggct
caggcaaagcaacgagctggcagagctgggagaacaggcccagggaagtgttataggctg
tacacagaacgtgcctaccgagatgaaatgctgaccaccaacgtgccagaaattcagaga
accaacttagcaagcacagtgctctcgctcaaggccatgggcatcaatgacctgctgtcc
tttgacttcatggatgccccaccaatggaaaccttgatcacagccatggagcaactgtac
acgctgggggccctggacgacgagggcctgcttactcgcctgggccgcaggatggcagag
ttccctctggagccaatgctgtgcaaaatgctgatcatgtctgtgcatctgggctgcagt
gaggaaatgctgaccattgtgtccatgctgtctgtgcagaacgtcttctacaggcccaaa
gataaacaagcccttgcagatcagaagaaggccaaattccaccagaccgaaggggaccac
ctcaccctgctggctgtgtacaactcctggaagaacaacaagttctccaacccatggtgc
tatgagaactttatccaggctcgttctctgcgccgggcccaggacattcgcaagcagatg
ctgggcataatggacaggcacaagctggatgtggtgtcctgtggtaagtccacagtccga
gtgcagaaggccatctgcagtggattcttccggaacgctgctaaaaaagacccacaggag
ggttaccggacactgatcgaccagcaagtggtctacatccatccgtccagtgctctcttc
aacagacagcccgaatgggtggtgtatcatgagctggtgctgaccacgaaggagtacatg
cgtgaggtcaccaccatcgacccccggtggcttgtggagtttgcgccggccttcttcaag
gtgtctgacccgaccaagctaagcaagcagaagaagcagcaacggctggaacccttgtac
aaccgctatgaggagcccaatgcctggagaatatcccgagccttccggcggcgctga

DBGET integrated database retrieval system