KEGG   Bos taurus (cow): 536154Help
Entry
536154            CDS       T01008                                 

Gene name
NCK1
Definition
(RefSeq) cytoplasmic protein NCK1
  KO
K07365  NCK adaptor protein 1
Organism
bta  Bos taurus (cow)
Pathway
bta04012  ErbB signaling pathway
bta04360  Axon guidance
bta04660  T cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    536154 (NCK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    536154 (NCK1)
  09158 Development
   04360 Axon guidance
    536154 (NCK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 SH3_10 hSH3 SH2_2
Motif
Other DBs
NCBI-GeneID: 536154
NCBI-ProteinID: NP_001069540
BGD-bta: BT27693
Ensembl: ENSBTAG00000018427
VGNC: 52804
UniProt: Q1LZB2
Position
1
AA seq 377 aa AA seqDB search
MAEEVVVVAKFDYVAQQEQELNIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKN
SARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAE
REDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSEKLA
AVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDIMDVIEKPENDPEWWKCRKINGMVG
LVPKNYVTIMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERG
HEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAP
IFTSEQGEKLYLIKHLS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagaggtggtggtggtagccaagtttgattatgtggcccagcaagagcaagag
ctgaacatcaagaagaatgagagactgtggcttctggatgactcaaagtcctggtggcga
gttcgaaattccatgaataaaacgggttttgtgccttctaactatgtggaaaggaaaaac
agtgctcggaaagcatctatcgtaaaaaacctaaaagataccttaggcattggaaaagtg
aaaagaaaacctagtgtgccagattctgcatctcctgctgatgatagctttgttgaccca
ggggaacgtctctatgacctcaacatgcctgcttatgtaaaatttaactatatggcagag
agagaggatgaattatcattgataaaagggacgaaggtgatcgttatggagaaatgcagt
gatgggtggtggcggggtagctacaatggacaagttggatggttcccttcaaactatgtg
actgaggaaggcgacagtcctttgggtgaccatgtgggttctttgtcagagaagttagca
gcagtcgtcaataacctaaatactgggcaagtgttacatgtggttcaggctctttaccca
ttcagctcgtccaatgatgaagaacttaattttgagaaaggagatataatggatgttatt
gaaaaacctgaaaatgatcctgagtggtggaaatgcaggaagatcaatggaatggttggt
ctggtgccaaaaaactatgttaccattatgcagaataacccattaacatcaggtttggaa
ccatcgcctccacagtgtgattacattaggccttcacttactggaaagtttgctggcaat
ccgtggtattatgggaaagtcaccaggcaccaagcagaaatggcattaaatgaaagaggg
catgaaggtgatttcctcattcgtgatagtgaatcttcgccaaatgatttctcagtatca
ctaaaagcacaagggaaaaacaagcattttaaagtacaactaaaagagactgtctactgc
attgggcagcgtaaattcagtaccatggaagaacttgtagaacattacaaaaaggcacca
atttttacaagtgaacaaggagaaaaattatatcttatcaagcatttatcatga

DBGET integrated database retrieval system