KEGG   Bos taurus (cow): 536213Help
Entry
536213            CDS       T01008                                 

Gene name
CHKB
Definition
(RefSeq) choline/ethanolamine kinase
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
bta  Bos taurus (cow)
Pathway
bta00564  Glycerophospholipid metabolism
bta01100  Metabolic pathways
bta05231  Choline metabolism in cancer
Module
bta_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
bta_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    536213 (CHKB)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    536213 (CHKB)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     536213 (CHKB)
    2.7.1.82  ethanolamine kinase
     536213 (CHKB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase
Motif
Other DBs
NCBI-GeneID: 536213
NCBI-ProteinID: NP_001193023
BGD-bta: BT14601
Ensembl: ENSBTAG00000016050
UniProt: G3X782
Position
5
AA seq 395 aa AA seqDB search
MAAEGTDVVGGGPLGGCLTKGSLLQAKCPDAAPSRRRGSARSRDAERRAYQWCREYLGGA
WRQARPEELRVDPVSGGLSNLLFRCSLPDHLPSVGEEPREVLLRLYGAILQGVDSLVLES
VMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTHELRDPVLSAAIATKMAKFHGMEMP
FTKEPHWLFGTMERYLKQIQDLPPTSLPQMNLLEMYSLKDEMGNLRKLLDTTPSPVVFCH
NDIQEGNILLLSEPKNTDSLMLVDFEYSSYNYRGFDIGNHFCEWVYDYTHEEWPFYKAQP
ANYPTEGQQLHFLRHYLAEVKKDETISQEEQRKLEADLLVEANRYALASHFFWGLWSILQ
ASMSTIEFGYLEYAQSRFQFYFQQKGQMTSFHPSS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgaggggaccgatgtggtcggaggcgggcctctcggaggctgcctgaccaag
ggcagcttgctgcaggctaagtgccccgacgcggccccgagccggcggcgtggctcggcg
cgctcacgagacgccgagcgccgcgcctaccagtggtgccgagagtacttgggcggggcc
tggcgccaggcgcggccggaggagctgagggttgacccagtgagcggaggcctcagcaac
ctgctcttccgctgctcgctgcccgaccacctgcccagcgttggcgaggagccccgggag
gtgctgctgcggctgtacggggccatcctgcagggcgtggactccttggtccttgaaagt
gtgatgttcgccatacttgcagagcggtcgctggggccccagctctacggagtctttcca
gagggccggctggaacagtacatcccaagccggccactgaagacacatgagcttcgagat
ccagtgttgtctgcagccattgccacgaagatggccaagttccacggcatggagatgcct
ttcactaaggagccccactggctattcgggaccatggagcggtacttaaagcagatccag
gacctgccccctaccagccttccccagatgaacctgctggagatgtacagcttgaaggat
gagatgggcaacctcaggaagctgctagacactaccccatcaccagtggtcttttgccac
aatgatatccaagaagggaacatcttactgctctcagagcctaaaaacaccgacagcctc
atgctggtggacttcgagtacagcagttataactacaggggctttgacatcgggaaccat
ttttgtgagtgggtttacgattatactcacgaggagtggcctttctacaaagcgcagcct
gcaaactaccccactgagggacagcagctccattttcttcgccactacctggcagaggta
aagaaagatgagaccatctcccaagaggagcagaggaaactggaagcagatttgctggtg
gaagctaatcggtatgccctggcatctcatttcttttggggtctctggtccatccttcag
gcatccatgtccactatagaatttggttacttggagtatgcgcagtctcggttccagttc
tacttccagcagaagggccagatgaccagcttccacccctcgtcctga

DBGET integrated database retrieval system