KEGG   Bos taurus (cow): 536863
Entry
536863            CDS       T01008                                 
Symbol
MPDZ
Name
(RefSeq) multiple PDZ domain protein
  KO
K06095  multiple PDZ domain protein
Organism
bta  Bos taurus (cow)
Pathway
bta04530  Tight junction
Brite
KEGG Orthology (KO) [BR:bta00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    536863 (MPDZ)
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2 Peptidase_M50 L27_2 MPDZ_u10 Tricorn_PDZ
Other DBs
NCBI-GeneID: 536863
NCBI-ProteinID: NP_001179820
BGD-bta: BT13451
Ensembl: ENSBTAG00000043961
VGNC: 31572
Position
8:31032746..31208083
AA seq 2070 aa
MLETIDKNRALQAAERLQAKLRERGDAANEDKLNLLKSVLQSPLFSQILNFQTSIQQLKD
QVNFATSTISNVEYGHIPHLSPGVIPTLQNESFLSSPNNGNLEVLTGFGTAHINGKPACD
EFDQLIKNMAQGRQIEVFDLLKPPCGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDG
RLKETDQILAINGQALDQTITHQQAISILQKAKDTVQLVIARGSLPQLISPIVSRSPSAA
STISAHSNPVHWQHVETIELVNDGSGLGFGIVGGKATGVIVKTILPGGVADQHGRLCSGD
HILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAIEEPTAPTSLGITLSSSPASTPE
MRVDASTQKSEESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDG
RIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVHLTLMRRTKQDAELASREDVTKDAV
LSPVNANVSKDNYQEDEDSLSLRRNTSILPIEEEGLPLVSAEREEIEDAQQQEAALLTKW
QRIMGINYEIVVAHVSKFSENSGLGISLEATVGHHFIRSVLPEGPVGHSGKLFSGDELLE
VNGITLLGENHQDVVTILKELPIEVTMVCCRRTVPPTAPSELESLDLCDIELTEKPHIDL
GEFIGSSETEDPVLTMTDVGRNAEEVQGPLAMWEADIQNIELEKGSQGLGFSILDYQDPV
DPASTVIVIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLENSSLEEAVQALKGAPSGTVRI
GVAKPLPLSPEEGYVSAKEDSFLYPPHSCEEEGLADKALFRADLALVNTNDADLADESAF
ESQYSPDNDSIYSTQASLLSLHGSACSDNLNYGPSLPSSPPKDIAENSSDSVLDLQMSLE
ELYAQNLLQRQDESAPSVDLSMGPASGFTVNDYTPANAIEQQYECDGLRAWTESHLPNEV
LSSAELSSPVLTDSTGKGSKFLIPQGSLASAAECVMLQNTPRESFERTIVIAKGNSSLGM
TVSANKDGLGVIVRSIIHGGAISRDGRIAVGDCILCINEESTISLTNAQARALLRRHSLI
GPDIKITYVPAEYLEEFKISLGQQSGGIMALDIFASYTGRDIPELPEREEGEGEESDLQN
AAYSNWNQPRRVELWREPSKSLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGKNG
TLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFLVQSIINRPRKSPLPSLPHNLYP
KYKFSSTNPFAGSLQFNADKVPSQSESEPENPPLCHSPPPQPPVLAEMSGDHALSSANET
SEDVDEEDEFGYSWKNIRERYGTLTGELHMIELEKGRSGLGLSLAGNKDRSRMSVFIVGI
DPNGAAGKDGQLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNKDAVSQMA
VCPGHTVEPSPATSENLQNKEAEPSVTTSEAVVDLSSLTNVQHLELPKDQGGLGIAISEE
DTVSGVIIKSLTEHGAAAKDGRLKVGDQILAVDDEVVVGYPVEKFINLLKTAKTKVKLTI
RAENPDSQATTSGTGTANGEKKSSPQSPVAPPSSSPEPEPMRSTSRSSTPAIFASDPATC
PIIPGCETTIEISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEV
NGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEDVYDTLTVELQKKPGKGLGLSI
VGKRNDTGVFVSDVVKGGIADADGRLLQGDQILTVNGEDVRHATQEAVAALLKCSLGTVT
LEVGRVKTGPFHSERRPSQSSQMSEASLSSFTFPLSGSGTPELLESSSKKNALASEIQGL
RTVEIKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICGTS
TEGMTHTQAVNLLKNASGSIEMQVVAGGDVSVVTGHQQEPASSSLSFTGLTSSSIFQDDL
GPPQCKSITLDRGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAV
NGQSLEGVTHEEAVAILKRTKGTVTLMVLS
NT seq 6213 nt   +upstreamnt  +downstreamnt
atgttagaaactatagacaaaaatcgggccctgcaggcagcagagcgcttgcaggccaag
ctgcgggaacgtggggatgcagcaaatgaagacaaactgaaccttctcaagtcagtgctg
cagagcccgctcttcagccagattctgaactttcagacttccatacagcagctgaaagac
caggtaaactttgcaacttcaacaatttcaaatgtcgagtatggtcacattcctcatctc
agcccaggtgtaattcctactctacaaaatgaatcatttttatcatccccaaataatgga
aatctggaagttcttacaggattcggtactgcacatatcaatgggaaacctgcttgtgat
gaatttgatcaactgatcaaaaatatggcccagggtcgccagatagaagtttttgacctc
ctcaaacctccatgtggaggccttgggttcagtgtggtgggactgaggagtgaaaaccgg
ggagagctgggtatatttgtgcaggagatccaggagggcagtgtggcccacagagatgga
agattgaaggaaactgaccaaatccttgctattaatggacaggcacttgatcagacaatt
acacatcagcaggccatcagcatcctgcagaaagccaaagatactgtccagctggttatt
gccagaggctcattgcctcagcttatcagccccatagtttcccgttctccatctgcggcg
agcacaatttcagctcattctaacccggttcactggcagcatgtggaaaccattgaattg
gtcaatgatggttctggtctgggctttggcatcgtaggaggaaaagcaactggtgtgatt
gtgaagaccattctgcctggaggtgtagctgatcagcatgggcgattatgcagtggagac
catattctaaagattggtgatacagatctagcaggaatgagcagtgagcaggtagcccaa
gtcctcagacagtgtggaaatagagtgaagttgatgattgcaagaggtgccattgaagaa
ccaacagcacctacctctttgggcatcaccctttcctcatccccggcttctacgccagaa
atgcgggttgatgcttcaactcagaaaagtgaagaaagtgagacatttgacgtagaactc
actaaaaatgtccaaggattaggaattaccattgctggatacattggagataaaaaatta
gaaccttcagggatctttgttaagagcattacaaagagcagtgctgtggaacatgatgga
agaatccaaattggagaccaaattatagcagtagatggcacaaaccttcagggttttacc
aatcaacaagcagtggaggtgttgcgacacacggggcagactgtgcacctgacgctaatg
agaagaactaagcaggatgctgaactggcgtcacgggaggacgtcacaaaagacgcagtt
ttgtctcctgttaatgcaaatgttagcaaagataattatcaagaagatgaagattcttta
tctctgaggagaaacaccagcatattaccaattgaagaagaaggtcttccattagtgtca
gctgagagagaagaaatagaagatgctcaacaacaggaagctgccctactgaccaagtgg
caaaggattatggggattaattatgaaattgtggtggctcatgtgagcaagttcagtgag
aacagcgggttgggaataagtctggaagcaacagtaggccatcattttattcgatctgtc
ctcccagaaggtcctgttggacacagtgggaagcttttcagtggagatgagctgttggaa
gtgaatggcataactctacttggggagaatcaccaggatgtggtgactattttaaaagag
ctgcctatagaggtgacaatggtgtgctgtcgtcgaacggtaccacctactgccccgtca
gagttggagagcctggacttatgtgacattgaactaacagaaaagcctcacatagatcta
ggtgagttcatcgggtcctcggagacagaggatcctgtgctgacaatgactgatgtgggt
cggaatgcagaggaagttcaaggacctttggctatgtgggaagccgatattcagaacata
gagctggagaaagggagccaaggacttggttttagcattttagattaccaggatccagtc
gatccagcaagcactgtgatcgtcattcgttctttggtgcctggtggaattgctgaaaag
gatggacgacttctccctggagatcgactcatgtttgtcaatgatgttaacttggaaaac
agcagtctcgaagaagctgtccaggccctgaagggtgcaccatcaggaactgtgagaata
ggagttgccaagcctttgcctctgtccccagaagagggttatgtttctgctaaggaggat
tcctttctctacccgccacattcctgcgaggaggaagggctggctgataaagccctcttc
agggctgacttggctctggtgaacacaaatgatgctgacttagcagatgaatctgccttt
gagtcacagtactctcctgataatgacagtatctactctactcaagcctctcttttatct
cttcatggcagtgcttgtagtgataacctgaattatggtccctcccttccatcttctcct
cccaaggatattgctgaaaattcctcagattcagtacttgatctgcagatgtccttggag
gagctatatgcccaaaatctcttgcaaagacaggacgagagtgcgccttcagtggacttg
agcatggggccggcttctggctttaccgtgaacgactatacacctgcaaatgctattgaa
cagcagtacgaatgtgacggcttaagagcgtggactgaatctcacctaccaaatgaagtt
ctgtcaagtgcagagctgagttctcctgtgctgactgattcgactggaaagggctccaag
ttcttaattccacaaggctccctggcctctgctgctgagtgtgtcatgctccaaaataca
cccagagaatctttcgagaggactattgtgatagcaaaaggcaattctagcttaggaatg
acagtaagtgctaataaagatggcttgggggtgattgttcgaagcattattcacggaggt
gccattagccgagatggtcggattgctgttggggactgcatcttgtgtattaatgaagaa
tctactatcagtttaaccaatgcccaggcacgagccctgttgagaaggcattctctcatt
gggcctgacataaaaattacttatgtacccgcagaatatttggaagagttcaaaataagc
ttggggcagcaatctggaggaataatggcactggatatttttgcttcctacactggcaga
gacattccagagctaccagagcgagaagaaggagagggggaagaaagtgaccttcaaaat
gcagcctacagcaactggaatcagcctaggcgggttgaactttggcgagaaccaagcaaa
tccttgggcatcagcattgttggtggacgagggatggggagtcgtctaagcaatggtgaa
gtgatgaggggcattttcatcaaacatgttcttgaagatagtccagctggcaaaaatgga
accctgaaacctggcgatagaatagtagaggtggatggcatggacctcagagatgcaagc
catgaacaagctgtggaagccattcggaaagcaggcaaccctgtagtctttctggtacag
agcattataaacagaccaaggaaatcccctttgccttccttgccgcacaacctttaccct
aagtacaagttcagcagcactaacccatttgctggttctctacagttcaacgctgacaag
gtgcccagtcagtcagaatcagagccagaaaaccctcctctgtgccactcgcctccaccc
cagcctccagtgttggcagaaatgagtggggatcacgctctgtcatctgcaaatgaaacc
tcagaagatgtggatgaagaggatgagtttggttacagctggaaaaatatcagagaacgt
tacggaaccctcacaggcgagctccacatgatcgaactagagaaaggtcgtagtggtttg
ggtctgagtcttgctgggaacaaagaccgatcgaggatgagtgtttttatagtggggatt
gatccaaatggagcagctgggaaagatggtcaactgcagattgcagatgagcttctagag
atcaatggtcaaattttatatggaagaagtcatcagaatgcttcatcaatcatcaaatgt
gccccttctaaagtaaaaataatttttatcagaaataaagatgcagtgagtcagatggct
gtatgtcctggacatacagtggaaccctcgcctgctacctcagagaatcttcaaaacaag
gaggctgaaccgagtgttactacttctgaggcagttgttgacctcagttcgttgacaaac
gtgcaacacctagaacttcctaaggatcaggggggtttgggcattgccataagtgaagaa
gatacagtcagtggggtcatcataaagagtctaacagagcatggggcagcagccaaggat
ggacggctgaaagttggagatcagatcttggctgtagatgatgaagttgttgttggctat
cctgttgaaaagtttattaaccttctgaaaactgcaaagacaaaagtgaaattgacgatt
cgtgctgagaatccagactcccaggctactacttcaggaactggtacagccaacggagag
aaaaagagcagcccccagtctccagtggccccaccgtctagctctccggaaccagagccc
atgcgaagtacaagcaggtcgtcaacaccagcaatctttgcttctgatcctgcaacctgc
cccatcatcccaggctgtgaaacaactattgagatttccaaagggcggacaggactgggc
ctgagcatcgttggggggtccgacacactgctgggtgccattattatccatgaagtttat
gaggaaggagcagcatgtaaagatggaagactctgggctggagatcagattttagaggta
aatggaattgacttgaggaaggccacacatgatgaagcaataaatgtcctaagacagaca
ccacaaagggtgcgcctgacgctgtacagagatgaggccccatacaaagaggaggacgtg
tatgacaccctcaccgtcgagctgcagaagaagccagggaaaggcctggggttgagtatt
gttggtaaaagaaatgatactggagtgtttgtgtccgatgttgtcaaaggaggcattgca
gatgctgatgggcgactgctacagggagaccagatactgacggtgaatggagaagacgtc
cgtcatgcaacgcaggaagccgttgcggctctgctgaagtgttccctaggtacagtaacc
ttggaagttggaagagtcaaaactggtccattccattcggagaggagaccttctcaaagc
agccagatgagtgaagccagcctgtcctcattcacttttccactttcgggatccggtaca
cctgagttactggaaagtagttcaaagaagaatgcattggcatctgaaatacagggatta
agaactgttgaaattaaaaaggggcccactgactcattgggtatcagcattgctggagga
gtgggcagtccactgggtgatgttcctatatttattgcgatgatgcacccgaatggagtt
gcagctcagacgcagaaactcagagttggggataggattgtcactatctgcggcacatcc
actgaggggatgactcacacccaggcagttaacttactgaaaaatgcctctggctccatt
gaaatgcaggtggttgctggaggagatgtgagtgtggtcacaggtcatcaacaggagcct
gccagttctagtctttctttcactgggctgacgtcaagtagtatatttcaggatgactta
gggcctcctcagtgtaagtctattaccctagaccgaggaccagatggcttaggcttcagt
atagtaggaggatatggcagtcctcatggagacttacccatttacgttaaaacagtgttt
gcgaagggagcagcctccgaagatggccgtctaaagaggggtgatcagatcattgctgtc
aatgggcagagtctggaaggcgtaacccatgaagaagccgttgccatccttaagcggaca
aaaggcactgtcactttgatggttctctcctga

DBGET integrated database retrieval system