KEGG   Bos taurus (cow): 537301Help
Entry
537301            CDS       T01008                                 

Gene name
APOA4
Definition
(RefSeq) apolipoprotein A-IV precursor
  KO
K08760  apolipoprotein A-IV
Organism
bta  Bos taurus (cow)
Pathway
bta04975  Fat digestion and absorption
bta04977  Vitamin digestion and absorption
bta04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:bta00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    537301 (APOA4)
   04979 Cholesterol metabolism
    537301 (APOA4)
   04977 Vitamin digestion and absorption
    537301 (APOA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Apolipoprotein ApoLp-III Baculo_PEP_C YtxH DUF883 DUF445 DUF1664 KapB DUF2884 DUF1845 ApoO Gp58 Exonuc_VII_L DUF1640 Prominin BshC DUF5324 ApoA-II Phage_Mu_Gam Phasin VirE ApoC-I DUF5427 Apo-CIII Pex19 Utp12
Motif
Other DBs
NCBI-GeneID: 537301
NCBI-ProteinID: NP_001032557
BGD-bta: BT16567
Ensembl: ENSBTAG00000019770
VGNC: 26024
UniProt: Q32PJ2
Position
15
AA seq 380 aa AA seqDB search
MFLKAVVLSLALVAVTGAEAEVNADQVATVIWDYFSQLGNNAKKAVEHIQKSELTQQLNT
LFQDKLGEVSTYTDDLQKKLVPFATELHERLTKDSEKLKEEIRKELEDLRARLLPHATEV
SQKIGDNVRELQQRLGPYAEELRTQVDTQAQQLRRQLTPYVERMEKVMRQNLDQLQASLA
PYAEELQATVNQRVEELKGRLTPYADQLQTKIEENVEELRRSLAPYAQDVQGKLNHQLEG
LAFQMKKHAEELKAKISAKAEELRQGLVPLVNSVHGSQLGNAEDLQKSLAELSSRLDQQV
EDFRRTVGPYGETFNKAMVQQLDTLRQKLGPLAGDVEDHLSFLEKDLRDKVSSFFNTLKE
KESQAPALPAQEEMPVPLGG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtttctgaaggctgtggtcctgagcctggccctggtggctgtcaccggagccgaggcg
gaggtcaatgccgaccaggtggccaccgtgatttgggactacttcagccagctgggcaac
aatgccaagaaggcggtggaacatatccagaagtctgagctcacccagcagctcaacacc
ctcttccaagataaacttggggaagtgagcacctacacggacgacctgcagaagaagctg
gtgccctttgccacggaactgcatgaacggctgaccaaggactccgagaagctgaaggag
gagattcggaaggagctggaggacctgcgggcccggctgctgccccacgccacggaggtg
agccagaagatcggggacaacgtgcgcgagctacagcagcgcctgggaccatacgcagag
gagctgcgcacccaggtcgacacccaggcgcagcagctgcggcgccagctgacgccctat
gtggagcgcatggagaaggtgatgcggcagaacctggaccagctgcaggcctcgctggcg
ccctacgccgaggagctccaggccacggtcaaccagcgcgtggaagagctcaaggggcgc
ctgacgccctacgcggaccagctccagaccaagatcgaggagaacgtggaggaactgcgc
cgcagcctggccccttatgctcaggacgtccaggggaagctcaaccaccagctggagggc
ctggcctttcagatgaagaagcatgccgaggagctaaaggccaagatctcagccaaagcc
gaggagctgcggcaggggctggtgcccctggtcaacagcgtgcatggaagtcagctgggc
aatgccgaggacttgcagaagtcactggccgagctgagcagccgcctggaccagcaggtg
gaggacttccgccgcaccgtggggccctacggcgagaccttcaacaaagccatggtgcag
cagctggacacgctcaggcagaagctgggccccctggcgggggacgtggaagatcacctg
agtttcctggagaaggatctgagggacaaggtcagcagcttcttcaacaccctcaaggag
aaagagagccaggcccccgccctccccgcgcaggaggagatgcccgtcccattggggggc
tga

DBGET integrated database retrieval system