KEGG   Bos taurus (cow): 537396Help
Entry
537396            CDS       T01008                                 

Gene name
PIK3C2B
Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta isoform X1
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
bta  Bos taurus (cow)
Pathway
bta00562  Inositol phosphate metabolism
bta01100  Metabolic pathways
bta04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    537396 (PIK3C2B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    537396 (PIK3C2B)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     537396 (PIK3C2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PI3K_rbd PX C2 DUF4135 HEAT_2
Motif
Other DBs
NCBI-GeneID: 537396
NCBI-ProteinID: XP_024832388
BGD-bta: BT26640
Ensembl: ENSBTAG00000024633
VGNC: 32886
Position
16
AA seq 1644 aa AA seqDB search
MSSTQGSGEHWKSLESVGISRKELAMAEALQMEYDALSRLRHDKEESRAKQNADPSLIGW
DEPVLDFYSKPAGRRKDLKLLRGLSGSDPTLNYNSVSPQEGLPNHSTSRGSQPGPDPWPK
GSLAEDYLYIFDGSDGGLSLSPGPRHREDSSKKLSPPPLPPRVSIWDTPPLPPRKGSPSS
SKVSQPSDINTFSSVEQPPGKLLGPGILEEEEELGGGSPGRPLGSVDYDGINDAITRLNL
KSTYDAEMLRDATRGWKEGRGPLDFAKDTPGKPVARSKTMPPQVPPRTYASRCANRKNAT
PGKNRRISAAPVGSRPHTVANGHELFEVSEERDEEVAAFCHMLDVHRSSPLFLHSLRSGS
DVQDYALTGYVWSAVTPSPEHLGDEVNLKVTVLCDSLREPLTFTCNCSSTVDLLIYQTLC
YTRDELRDVDVGDFVLKPCGLEEFLQNKHALGSHEYIQYCRKFGIDIRLQLMEQKAVRGD
LARTVNDDQSPSTLNYLVHLQERPVKQTISRQALSLLFDTYHNEVDAFLLADGDFPLKAD
RVVQSVKAICNALAAVETPEITSALNQLPPCPSRVKPKIQKDPTVLAMKENREKVVEALT
AAILDLVELYCNTFNADFQPAVPGSRKHTLVQEACHLSGPLAFTVYATHRIPITWATSYE
EFYLSCSLSHGGKELCSPLQTRRVHFSKYLFHLVIWDQQICFPVQLNRLPRETLLCATLY
ALPVPPPGSSSEANKQRRVPEALGWVTAPLFNFRQVLTCGRKLLGLWPATQESPSARWSA
PNFHQPDSVILQIDFPTSAFDIKFTSPAGDKFSPRYEFGSLREEDQHVLKNIMQKESLHW
LTDADKKRLWEKRYYCHAEVSALPLVLASAPSWEWACLPDTYALLAQWTPMNHQDALGLL
HATFPDQEVRRMAVQWIGSLSDAELLDYLPQLVQALKYECYLDSPLVRFLLKRAVSDLRV
THYFFWLLKDGLKDSQFSIRYQYLLAALLCCCGKGLREEFNRQCWLVNTLAKLAQQVREA
APSARQGILRAGLEEVEQFFVLNGSCRLPLSPSLLVKGVVPRDCSYFNSNAVPLKLSFQN
VDPLGENIRVIFKCGDDLRQDMLTLQMIRIMSKIWVQEGLDMRMVIFRCFSTGRGRGMVE
MIPNSETLRKIQVEHGVTGSFKDRPLADWLQKHNPGEDEYEKAVENFIYSCAGCCVATYV
LGICDRHNDNIMLKTTGHMFHIDFGRFLGHAQMFGNIKRDRAPFVFTSDMAYVINGGDKP
SSRFHDFVDLCCQAYNLIRKHTHLFLNLLGLMLSCGIPELSDLEDLKYVYDALRPQDTEA
NATTYFTRLIESSLGSVATKLNFFIHNLAQMKFLGSDDRLTLSFAPRTHTLKSSGRISDV
FLCRHEKVFHPNKGYIYVVKVMRENAHEAAYIQRTFEEFQELHNKLRLLFPSSLLPSFPS
RFVIGRSRGEAGAERRREELNGYIWHLVHAAPEVAECDLVYTFFHPLPRDEKTAGSSLAP
KSSEGTWARPVGRVGGEVKLSISYKNNKLFIMVMHIRGLQLLQDGNDPDPYVKIYLLPDP
QKTTKKKTKVARKTCNPTYNEMLVYDGIPKGDLQQRELQLSVLSEQGFWENVLLGEVHIR
LRELDLAQEKTGWFALGSRSPETL
NT seq 4935 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgactcagggcagtggggaacactggaagtccctggagtcggtgggcatcagc
cgcaaagaactggccatggctgaagccttgcagatggagtacgatgcgctgtcccggctt
cggcacgacaaggaggaaagcagggcaaagcagaacgcagacccctctctgatcggctgg
gatgagcctgttctggacttctacagcaagccagcgggaaggcggaaggacctcaagctc
ttacgcggtctttctggctccgatcctaccctcaattacaactcagtctccccacaggaa
gggctgcccaaccactctacctcccggggctcccagcctggcccagatccctggcccaaa
ggctccctggccgaagactatctctacatttttgatggttcagatggggggctctccttg
tccccaggaccaaggcacagagaagactcttctaagaaactgtccccgcctcctctgcct
ccccgagtctctatctgggatactcctcccctgcctcccagaaaggggtccccctcctct
tccaaggtttcccagcccagtgacatcaacactttctcttcagttgaacaacctccaggc
aagttgctggggcccgggatcctagaagaggaggaggagctgggaggtgggagtccgggg
cggccgctgggttccgtggactacgacggcattaacgatgccatcacacggctgaacctg
aagtcgacctacgacgcagagatgctgcgggatgccaccaggggctggaaggagggtcgg
gggcccctggactttgccaaggacactcctgggaagcccgtggcccggagcaagaccatg
cccccacaggtgcccccccgcacatacgcctcccgctgtgccaaccggaaaaacgcaaca
cccggcaagaaccgccgcatttctgcagccccggtgggctcccggccccacaccgtcgcc
aatggccacgagctgtttgaggtctcagaggagagagatgaggaagttgctgcattttgc
cacatgctggatgtgcacaggtcttcccctctcttcctgcacagcctccgatccggctct
gatgtccaggactacgccctcactgggtatgtctggagcgctgtcaccccgagcccggag
cacctcggggacgaggtgaacctgaaggtgaccgtgctgtgcgacagcctgcgggagccg
ctcacttttacctgcaactgctcctccactgtagacttgctcatctaccagaccctgtgc
tacacccgtgatgaactgagggatgtcgacgtgggtgactttgtgctgaagccctgtggg
ctggaggagttcctgcagaacaagcacgccctgggcagccacgagtatattcagtactgt
cggaagttcggcatcgatatccggctgcagctgatggagcagaaggccgtgcgcggtgac
ctggcccgcacggtgaatgatgaccagagcccctccaccttgaactacctcgtccacctg
caagagaggccagtcaagcagaccatcagcaggcaggccctgagtcttctgttcgacact
taccacaatgaggtggatgccttcctgttggctgacggggacttcccactgaaggccgac
agggtggtccagtccgtcaaggccatctgcaacgccctagccgctgtggaaacccctgag
atcaccagcgctctcaaccagctgcccccctgcccttcccgagtgaagcctaaaatccag
aaggatcccaccgtcttggccatgaaggaaaaccgagagaaggttgtggaagccctgacg
gctgccatcttggacctggtggagctgtactgcaacacgttcaacgcagacttccagccc
gcggtgcctgggagccgcaagcacaccctggttcaggaggcctgccatctctcggggccg
ctggccttcacggtctatgccacccaccgcatcccgatcacctgggctaccagctatgaa
gagttctacctctcctgctccctcagccacggcggcaaggagctgtgcagccccctgcag
acccgacgggtccacttctccaagtacctcttccacctcgtcatctgggaccagcagatc
tgcttccctgtgcagctgaaccggctgcctcgggagaccctgctgtgtgccaccctctac
gctctgcccgtgcccccgccggggagctcctcggaggccaacaagcagcggcgggtgccc
gaagccctgggctgggtcactgctccgctcttcaacttcaggcaagtcctgacctgtggc
cggaagcttctgggcttatggccagcaacacaggaaagtcccagtgcccgctggagtgca
cctaatttccatcagccagatagtgtgatcctgcagattgactttcccacctcggccttt
gacatcaagttcaccagccctgctggagacaagttcagcccccgctatgagtttggcagc
ctccgggaggaagaccaacatgtgcttaaaaacatcatgcagaaggaatccctgcactgg
ctcacggatgccgacaaaaagcgcctgtgggagaagcggtattactgccacgcggaggtg
agcgcgctgccgctggtgcttgccagcgcgcccagctgggagtgggcgtgcctccccgac
acctatgctctgctggcgcagtggacccccatgaaccaccaggacgccctggggctcctg
cacgccacgtttccagaccaggaggtgcgtcgcatggctgtacagtggatcggctccctc
tccgatgccgagctgctggactacttgccccagctcgtgcaggccttaaagtatgaatgc
tacctggacagccccttggtgcgcttcctcctgaagcgagcggtctctgacttgagagtg
actcactacttcttctggttgctgaaggacggcctcaaagactctcagttcagcatccgc
taccagtacctgctggccgccttgttgtgttgctgtggcaaggggctgagagaggagttt
aaccgccagtgctggcttgttaataccctggccaaactggcccagcaggtccgggaggct
gccccgtctgcacggcagggcatcctccgtgccggcctggaggaggtggagcagttcttc
gtcctcaatggctcctgccgcctgcccctcagccccagtctgctggttaagggcgtcgtg
cccagggactgttcctacttcaactccaacgctgttcccctcaagctctccttccaaaac
gtggacccactgggcgagaacatccgtgtcatcttcaagtgtggggacgaccttcgccag
gacatgctgaccctgcagatgatccgcatcatgagcaagatctgggtccaggagggcctg
gacatgcgcatggtcatcttccgctgcttctccaccggccgggggagagggatggtggag
atgatccccaactctgagaccctgcgcaagatccaggtggagcacggggtgaccggttcc
tttaaggaccggcccctcgccgactggctgcagaagcacaaccctggggaggacgagtat
gagaaggctgtagagaacttcatctactcctgtgccggctgctgtgtggccacctacgtc
ctgggcatctgtgaccgacacaacgacaacatcatgctgaagacgactggccacatgttc
cacatagatttcggccgcttcctgggccatgcccagatgttcggcaacatcaagcgggac
cgcgccccctttgtcttcacctcggacatggcgtatgtcatcaacgggggtgacaagcct
tccagccgcttccatgattttgttgacctttgctgccaagcctacaacctcattcgcaag
cacacccacctcttcctcaaccttctgggcctgatgttgtcctgtgggatccctgaactc
tcagacctggaagacctcaagtacgtgtacgatgccctgaggcctcaggacacggaggcc
aacgccactacctacttcaccaggttgatcgagtccagccttggcagtgtagccacaaag
ctcaatttttttattcataacctggctcagatgaagtttttaggctcagatgatcggctg
accctctcctttgctccacgaacacacactctcaagagctcaggccgcataagcgatgtg
tttctctgtcgccacgagaaggtcttccaccccaacaagggctatatttacgtggtaaag
gtgatgcgagagaatgctcacgaggccgcttacatccagcggacatttgaggagttccag
gagttacacaataagctacggctgctcttcccttcttccctcttgcccagcttccccagt
cgcttcgtgattggccgctcgcgaggagaggcaggggccgagcggcgccgggaggagcta
aacggatacatctggcacttggtccacgcggccccggaggtggccgagtgtgatttggtg
tacaccttcttccaccccctgcccagggatgagaagacggcaggcagcagcctggctccc
aagtcctcagaaggcacatgggcccggccagtcgggagggttggaggagaggtgaaactg
tccatctcctacaaaaacaataaactcttcatcatggtgatgcacattcggggcttgcaa
ctgctccaggatgggaatgatcccgacccctatgtcaagatttacctccttcctgaccct
cagaaaaccactaagaagaaaaccaaagtggcccggaaaacctgcaaccccacctacaat
gagatgctggtgtatgatggaatccccaagggtgacctgcagcagcgggagctgcagctg
agtgtgctgagtgagcaagggttctgggagaacgtgctcctcggggaagtgcacatccgc
ctgcgagagctggacctggcccaggagaagactggctggtttgcactgggatctcgaagt
cctgagaccttatga

DBGET integrated database retrieval system