KEGG   Bos taurus (cow): 537451Help
Entry
537451            CDS       T01008                                 

Gene name
GYS2
Definition
(RefSeq) glycogen [starch] synthase, liver
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
bta  Bos taurus (cow)
Pathway
bta00500  Starch and sucrose metabolism
bta01100  Metabolic pathways
bta04151  PI3K-Akt signaling pathway
bta04152  AMPK signaling pathway
bta04910  Insulin signaling pathway
bta04922  Glucagon signaling pathway
bta04931  Insulin resistance
Module
bta_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    537451 (GYS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    537451 (GYS2)
   04152 AMPK signaling pathway
    537451 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    537451 (GYS2)
   04922 Glucagon signaling pathway
    537451 (GYS2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    537451 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bta01003]
    537451 (GYS2)
Enzymes [BR:bta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     537451 (GYS2)
Glycosyltransferases [BR:bta01003]
 Polysaccharide
  Storage polysaccharide
   537451 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_4_4 Glyco_transf_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 537451
NCBI-ProteinID: NP_001179834
BGD-bta: BT10077
Ensembl: ENSBTAG00000013333
VGNC: 29731
Position
5
AA seq 702 aa AA seqDB search
MLRGRSLSVTSLGGLPRWEAGLPVENLLLFEVSWEVTNKVGGIYTVIQTKAKTTADEWGD
NYFLIGPYFEHNMKTQVEQCEPVNDAVRRAMDTMNKHGCQVRFGRWLIEGSPYVVLFDIG
YSAWNLDKWKGDLWEACSVGIPYHDQEANDMLIFGSLTAWFLKEVTDHADGRHVIVQFHE
WQAGIGLILSRARKLPIATVFTTHATLLGRYLCAANIDFYNHLDKFNIDKEAGERQIYHR
YCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMYK
ARIQEFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLRMHKSDVT
VVVFFIMPAKTNNFNVETLKGQAVRKQLWDTAHSVKEKFGKKLYDALLRGEIPDMNNILD
RDDMTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNSRTDRVKLILHPEF
LSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQEH
VADPTAYGIYIVDRRFCSPDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRYL
GRYYQHARHLTLSRAFPEKFHMEPTSPPTTEGFKYPRPPSVPPSPSGSQGSSPQSSDAED
DDEDERYDEEEEAERDRLNIKSPFSLSHVSRGKKKQHGEYKN
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgaggtcgatcgctatctgtgacatccctaggtgggctgcctcggtgggaagcc
ggacttcctgtggagaatttactgctctttgaagtctcttgggaagtgaccaataaagtc
ggtggcatctatactgtgattcagacaaaggccaaaacaacagcagatgaatggggagac
aactattttctgattggtccatattttgagcataatatgaagactcaggtggaacagtgt
gaacctgtgaatgatgctgttagaagagccatggacacgatgaacaaacacggctgccag
gtgcgctttggaagatggctgatagaagggagtccttacgtggttctctttgacattggc
tattcggcttggaacctggacaagtggaaaggagacctctgggaagcatgcagcgttggc
attccttatcacgaccaggaagccaatgatatgctgatctttgggtcattaactgcctgg
ttcttgaaagaggtgacggaccatgctgatgggagacatgtcattgtccagttccatgaa
tggcaagctgggattggactgatcctttctcgagctcggaaactgcccattgctacagtc
tttaccacccacgccacactgcttgggcggtatctttgtgcagctaacatcgatttctac
aaccaccttgataagtttaacatagacaaagaggctggggaaaggcagatttatcaccgg
tattgcatggagcgcgcttccgtccattgtgctcatgttttcaccacagtttctgaaatt
accgcaatagaggcagaacacatgctgaagagaaaacctgatgtagttactccaaatggc
ttgaacgttaagaaattttcagctgtacatgagtttcaaaatctccatgctatgtacaag
gccagaatccaagagtttgttcgaggtcatttctatggtcatctggactttgatcttgaa
aaaacgttattcctcttcattgctgggaggtatgagttttcaaacaaaggagctgacatc
ttcttagaatccttatccaggttaaacttcctgctgaggatgcataaaagtgatgtcacc
gtggtggtgtttttcattatgcctgccaagacaaacaatttcaatgtggaaaccctgaaa
ggccaggcagtgcgcaaacagctatgggacactgcacattctgtgaaggaaaagtttgga
aagaaactgtatgatgcattattaagaggagaaattcctgacatgaacaatattttggac
cgagatgatatgacaattatgaaaagagctatcttttcaactcagcggcagtctttgccc
ccagtgactactcacaacatgattgatgattccaccgatcccatcctcagcaccattaga
cgtatcgggctcttcaatagccgcacagacagagtcaagttgattttgcacccagagttc
ctgtcctccaccagccccttgctacccatggattatgaagagtttgtccgaggttgtcat
cttggagtatttccatcttactatgaaccctggggttatactccagctgaatgcactgtg
atgggcatccccagtgtgaccaccaatctctctggctttggctgtttcatgcaggaacat
gtggctgaccccactgcatacggaatttacatcgttgacaggcggttctgctcacccgat
gattcttgcaatcagctgactcagtttctctatggattttgcaaacagtcacgccgccag
aggattattcaaaggaatcgaaccgagaggctctcagatcttctggactggagatactta
ggcagatattaccagcatgccaggcacctgacattaagcagagcctttccagaaaaattc
cacatggaacccacatcaccaccaacgacagaagggtttaagtatcccaggccgccctcg
gtaccaccttctccgtcgggatctcagggctccagtcctcagagcagcgatgcggaggat
gacgatgaggatgagagatacgacgaggaggaagaggccgaaagggatcggttaaatatc
aagtctccgttttctctgagtcacgtttctcgcgggaagaagaagcagcacggagaatac
aagaattga

DBGET integrated database retrieval system