KEGG   Bos taurus (cow): 538244
Entry
538244            CDS       T01008                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1
  KO
K04829  acid-sensing ion channel 1
Organism
bta  Bos taurus (cow)
Pathway
bta04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    538244 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bta04040]
    538244 (ASIC1)
Ion channels [BR:bta04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   538244 (ASIC1)
SSDB
Motif
Pfam: ASC EFP
Other DBs
NCBI-GeneID: 538244
NCBI-ProteinID: NP_001179862
BGD-bta: BT21884
Ensembl: ENSBTAG00000000970
VGNC: 26210
UniProt: F1MTH0
Position
5
AA seq 526 aa
MELKAEEEEVGGLQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCV
CTERVQYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNN
RYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCS
AEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETS
FEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDLDFF
DSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEYCV
CEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETIEQ
KKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKRSSADK
GVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC
NT seq 1581 nt   +upstreamnt  +downstreamnt
atggaactgaaggctgaggaggaggaggtgggtggcctccagccggtgagcatccaggcc
ttcgccagcagctccaccctgcatggcctggcccacatcttctcctacgagcggctgtct
ctgaagcgggcgctctgggccctctgcttcctgggctccctggctgtgctgctgtgtgtg
tgcaccgagcgtgtgcagtactacttccactaccaccacgtcaccaagctcgatgaggtg
gctgcctcccagctcaccttccctgccgtcacgctgtgcaacctcaacgagttccgcttt
agccaagtctccaagaatgacctgtaccatgccggggagctgctggccctgctcaacaac
aggtatgagataccagacacgcagatggcagatgaaaagcagctggagatactgcaggac
aaggccaactttcgcagcttcaagcccaagcccttcaacatgcgcgagttttatgaccgc
gcagggcacgacatccgagacatgctgctttcctgccacttccggggggaggtctgcagc
gccgaggacttcaaggtggtcttcacgcggtatggaaagtgctacacgttcaactctggc
cgagatgggcgcccacggctgaagaccatgaagggtgggacgggcaacgggctggagatc
atgctggacattcagcaggacgagtacctgcccgtgtggggggaaaccgatgagacgtcc
ttcgaagcaggcatcaaagtgcagatccacagtcaggatgaacctcccttcatcgaccag
ctgggctttggcgtagccccagggttccagacctttgtggcctgccaagagcagcggctc
atctacctgcccccgccctggggcacctgcaaagctgttaccatggacttggatttcttc
gactcctacagcattaccgcctgccgcatcgactgtgagacgcgctacctggtggagaac
tgtaactgccgcatggtgcacatgccaggggacgccccatactgcactccagagcagtac
aaggagtgtgcagatcctgctctggacttcctggtggagaaggaccaggaatactgtgtg
tgtgaaatgccctgcaacctgacccgctatggcaaggagctgtccatggtcaagatcccc
agcaaagcgtcagccaaatacttggccaagaagttcaacaagtctgagcagtacataggg
gaaaacatcctggtgctggacattttctttgaagtcctcaactatgagaccattgagcag
aagaaggcctatgagattgcagggctcctgggtgacattggaggccaaatggggctgttc
atcggggccagcatcctcacggtgctggaactctttgactacgcctacgaggtcataaaa
cacaagctgtgcagaagagggaagtgccagaaggaggccaaacggagcagcgcggacaag
ggcgtggccctcagcctggatgacgtcaaaagacacaacccgtgcgagagcctccggggc
catcctgccgggatgacgtatgcggccaacatcctacctcaccatccggcccgaggcact
tttgaggactttacctgctga

DBGET integrated database retrieval system