KEGG   Bos taurus (cow): 538602Help
Entry
538602            CDS       T01008                                 

Gene name
EXT1
Definition
(RefSeq) exostosin-1
  KO
K02366  glucuronyl/N-acetylglucosaminyl transferase EXT1 [EC:2.4.1.224 2.4.1.225]
Organism
bta  Bos taurus (cow)
Pathway
bta00534  Glycosaminoglycan biosynthesis - heparan sulfate / heparin
bta01100  Metabolic pathways
Module
bta_M00059  Glycosaminoglycan biosynthesis, heparan sulfate backbone
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    538602 (EXT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bta01003]
    538602 (EXT1)
Enzymes [BR:bta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.224  glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase
     538602 (EXT1)
    2.4.1.225  N-acetylglucosaminyl-proteoglycan 4-beta-glucuronosyltransferase
     538602 (EXT1)
Glycosyltransferases [BR:bta01003]
 Glycan extension
  O-Glycan
   538602 (EXT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_64 Exostosin
Motif
Other DBs
NCBI-GeneID: 538602
NCBI-ProteinID: NP_001091564
BGD-bta: BT24285
Ensembl: ENSBTAG00000006209
VGNC: 28665
UniProt: A5D7I4
Position
14
AA seq 746 aa AA seqDB search
MQAKKRYFILLSAGSCLALLFYFGGLQFRASRSHSRREEHSGRNGLHHPSPDHFWPRFPD
ALRPFVPWDQLENEDSSVHVSPRQKREANSSIYKGKKCRMESCFDFTLCKKNGFKVYVYP
QQKGEKIAESYQNILAAIEGSRFYTSDPSQACLFVLSLDTLDRDQLSPQYVHNLRSKVQS
LHLWNNGRNHLIFNLYSGTWPDYTEDVGFDIGQAMLAKASISTENFRPNFDVSIPLFSKD
HPRTGGERGFLKFNTIPPLRKYMLVFKGKRYLTGIGSDTRNALYHVHNGEDVVLLTTCKH
GKDWQKHKDSRCDRDNTEYEKYDYREMLHNATFCLVPRGRRLGSFRFLEALQAACVPVML
SNGWELPFSEVINWNQAAVIGDERLLLQIPSTIRSIHQDKILALRQQTQFLWEAYFSSVE
KIVLTTLEIIQDRIFKHISRNSLIWNKHPGGLFVLPQYSSYLGDFPYYYANLGLKPPSKF
TAVIHAVTPLVSQSQPVLKLLVAAAKSQYCAQIIVLWNCDKPLPAKHRWPATSVPVIVIE
GESKVMSSRFLPYDNIITDAVLSLDEDTVLSTTEVDFAFTVWQSFPERIVGYPARSHFWD
NSKERWGYTSKWTNDYSMVLTGAAIYHKYYHYLYTHYLPASLKNMVDQLANCEDILMNFL
VSAVTKLPPIKVTQKKQYKETMMGQTSRASRWADPDHFAQRQSCMNTFASWFGYMPLIHS
QMRLDPVLFKDQVSILRKKYRDIERL
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccaaaaaacgctatttcatcctgctctcagctggctcttgtctcgcccttttg
ttttatttcggaggcttgcagtttagggcatcgagaagccacagccggagagaagagcac
agcggtcggaatggcttgcaccatccgagtccggatcatttctggccccgcttcccggac
gctctgcgccccttcgttccctgggatcaattggaaaacgaggattccagtgtgcacgtt
tcgccccggcagaagcgagaggccaactcgagcatctacaaaggcaagaagtgccgcatg
gagtcctgcttcgatttcaccctttgcaagaaaaacggcttcaaagtctacgtctaccca
cagcaaaaaggggagaaaattgctgaaagttaccaaaacattctagcggccatcgagggc
tccaggttctatacctcggaccccagccaggcgtgcctctttgtcctgagtctggacact
ttagaccgagaccagttgtcacctcagtatgtgcacaatttgagatccaaagtgcagagt
ctccacttgtggaacaacggtaggaatcatttaatttttaatttatattccggcacttgg
cctgactacaccgaggacgtggggtttgacatcggccaggcgatgctggctaaagccagc
atcagtactgaaaacttccgacccaactttgatgtttctattcccctcttttctaaggat
catcccaggacaggaggggagagggggtttttgaagtttaacactatccctcctctcagg
aagtacatgctggtcttcaaggggaagaggtacctgacagggatagggtcagacaccagg
aatgccttatatcacgtccataacggggaggacgtagtgctgctcaccacctgcaagcat
ggcaaagactggcagaagcacaaggattctcgctgtgaccgggacaacaccgagtacgag
aaatatgattatcgggaaatgctgcacaatgccactttctgtctggttcctcgtggtcgc
aggcttgggtccttcaggttcctggaggctctgcaggccgcctgtgtccctgtgatgctc
agcaatggatgggagttgccattctctgaagtgattaattggaaccaagctgccgtcata
ggcgatgagagattgttattacagattccttctacaatcaggtctattcatcaggataaa
atcctagcacttagacagcagacacaattcttgtgggaggcttatttttcttcagttgag
aagattgtattaactacactagagattattcaggacagaatattcaagcacatatcacgc
aacagtttaatatggaacaaacatcctgggggattgttcgtcctaccacagtattcatct
tatctgggagatttcccttactactatgctaatttaggtttaaagcccccctccaaattc
actgcagtcatccacgcggtgacccccctggtctctcagtcccagccagtgttgaaactc
ctcgtggctgcagccaagtcccagtactgtgcccagatcatagttctatggaattgtgac
aagccccttccagccaaacaccgctggcctgccacttctgtgcctgtcattgtcattgaa
ggagaaagcaaggtgatgagcagccgtttcctgccctacgacaacatcatcacagatgct
gtgctcagccttgacgaggacaccgtgctttcaaccacggaggtggattttgccttcacc
gtgtggcagagcttccccgagaggattgtggggtaccccgcacgcagccatttctgggac
aactctaaggagcggtggggctacacgtccaagtggacgaacgactactccatggtgttg
acgggagctgctatttaccacaaatattatcactacctttacacccattacctgccagcc
agcctgaagaacatggtggaccaattggccaactgtgaggacatactcatgaatttcctg
gtgtctgctgtgacaaaattgcctccaatcaaagtgacccaaaagaagcagtataaggag
acaatgatgggacagacctctcgggcttcccgctgggctgaccctgaccactttgcccag
cgacaaagctgcatgaatacgtttgccagctggtttggctacatgccgctgatccactct
cagatgaggctggaccccgtcctctttaaagaccaggtctctattctgcggaagaaatac
cgagacatcgagcggctttga

DBGET integrated database retrieval system