KEGG   Bos taurus (cow): 538627Help
Entry
538627            CDS       T01008                                 

Gene name
WNT16
Definition
(RefSeq) protein Wnt-16 precursor
  KO
K01558  wingless-type MMTV integration site family, member 16
Organism
bta  Bos taurus (cow)
Pathway
bta04150  mTOR signaling pathway
bta04310  Wnt signaling pathway
bta04390  Hippo signaling pathway
bta04550  Signaling pathways regulating pluripotency of stem cells
bta04916  Melanogenesis
bta04934  Cushing syndrome
bta05165  Human papillomavirus infection
bta05200  Pathways in cancer
bta05202  Transcriptional misregulation in cancer
bta05205  Proteoglycans in cancer
bta05217  Basal cell carcinoma
bta05224  Breast cancer
bta05225  Hepatocellular carcinoma
bta05226  Gastric cancer
Module
bta_M00677  Wnt signaling
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    538627 (WNT16)
   04390 Hippo signaling pathway
    538627 (WNT16)
   04150 mTOR signaling pathway
    538627 (WNT16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    538627 (WNT16)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    538627 (WNT16)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    538627 (WNT16)
   05202 Transcriptional misregulation in cancer
    538627 (WNT16)
   05205 Proteoglycans in cancer
    538627 (WNT16)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    538627 (WNT16)
   05226 Gastric cancer
    538627 (WNT16)
   05217 Basal cell carcinoma
    538627 (WNT16)
   05224 Breast cancer
    538627 (WNT16)
  09167 Endocrine and metabolic diseases
   04934 Cushing syndrome
    538627 (WNT16)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    538627 (WNT16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bta00536]
    538627 (WNT16)
Glycosaminoglycan binding proteins [BR:bta00536]
 Heparan sulfate/Haparin
  Morphogens
   538627 (WNT16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 538627
NCBI-ProteinID: NP_001014949
BGD-bta: BT18611
Ensembl: ENSBTAG00000002940
VGNC: 36956
UniProt: Q5E9U6
Position
4
AA seq 362 aa AA seqDB search
MDRAALLGLSRLCALWAAVLALFPCGAQGNWMWLGIASFGVPEKLGCANLPLNSRQKELC
KRKPYLLPSIREGARLGIQECRSQFRHERWNCLVAAASAPGTSPLFGYELSSGTKETAFI
YAVMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSSSEGWHWGGCSDDVQYGMWFSRKFL
DFPIKNTTAKESKVLLAMNLHNNEAGRQAVAKLMSLDCRCHGVSGSCAVKTCWKTMSSFE
KIGHLLKDKYENSVQISDKIKRKMHRREKDQRKIPIRKDDLLYVNKSPNYCVEDKKLGIP
GTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDVHT
CK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggacagagcagcgctcctgggactgtcccgcctgtgcgcgctgtgggcagccgtgctc
gcgctgttcccctgcggagcccaaggaaactggatgtggttgggcatcgcctcctttggg
gttccggagaagctgggctgtgccaacttgcctctgaacagccgccagaaggagctgtgc
aagaggaaaccgtacctgctgccgagcatccgcgagggcgcccggctgggcattcaggag
tgcagaagccagttcaggcacgagagatggaactgcctggtggccgccgcctccgcgccg
ggcaccagccctctctttggctacgagctgagcagcggcaccaaggaaacagcatttatt
tatgctgtgatggctgcaggcctggtgcattctgtgaccaggtcatgcagcgcaggcaac
atgaccgagtgttcctgtgacaccaccttgcagaacggcggctcatcgagtgaaggctgg
cattgggggggatgctctgatgatgtccagtatggcatgtggttcagcagaaagttccta
gatttccccatcaaaaacaccacggcaaaggaaagcaaagtactgttagcaatgaaccta
cataacaatgaagctggaaggcaggctgtcgccaagttgatgtccttagactgccgttgt
cacggagtttctggctcctgcgctgtgaaaacatgctggaaaacaatgtcttcttttgaa
aagattggccatctgttgaaggataaatatgaaaacagtgtgcaaatctcagacaaaata
aagaggaaaatgcacaggagagaaaaagatcagaggaaaataccaatccgcaaggatgat
ctgctctacgtcaataagtctcccaattactgtgttgaggataagaaactcgggatccca
gggactcaaggcagagagtgcaaccgcacgtcggagggcgcagatggctgcaacctcctc
tgctgtggccgaggctacaacacgcatgtggtcaggcacgtggagagatgtgaatgcaaa
tttatctggtgctgttatgtccgctgcaggaggtgtgaaagcatgactgatgtccacact
tgcaagtaa

DBGET integrated database retrieval system