KEGG   Bos taurus (cow): 538772Help
Entry
538772            CDS       T01008                                 

Gene name
DARS2
Definition
(RefSeq) aspartate--tRNA ligase, mitochondrial precursor
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
bta  Bos taurus (cow)
Pathway
bta00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    538772 (DARS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bta01007]
    538772 (DARS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bta03016]
    538772 (DARS2)
   03029 Mitochondrial biogenesis [BR:bta03029]
    538772 (DARS2)
Enzymes [BR:bta01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     538772 (DARS2)
Amino acid related enzymes [BR:bta01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   538772 (DARS2)
Transfer RNA biogenesis [BR:bta03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    538772 (DARS2)
 Prokaryotic Type
   Other AARSs
    538772 (DARS2)
Mitochondrial biogenesis [BR:bta03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    538772 (DARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon
Motif
Other DBs
NCBI-GeneID: 538772
NCBI-ProteinID: NP_001095692
BGD-bta: BT28128
Ensembl: ENSBTAG00000004358
VGNC: 27882
UniProt: A6QPU5
Position
16
AA seq 651 aa AA seqDB search
MFCWLSRLCGELSTPTRRTTQLIWSSAARSMVLSSQRIPELSSFVARTNTCGELRSSHLG
QEVTLCGWIQFRRQNIFLVLRDFHGLVQVVIPQDESAASVKKILCEAPMESVVQVSGTVI
SRPPGQKNPKMPTGEIEIKVKTAKLLNSCKKLPFEIKDFMKKTETLRLQYRYLDLRSVQM
QYNLRLRSQMVMKMREYLCNLHGFVDVETPTLFKRTPGGAKEFVIPSREPGKFYSLPQSP
QQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGVQSLIEGLLQY
SWPSDKDPLVVPFPSMPFAEALASYGTDKPDTRFGMKIVDISDMFRNTEVGFLQDALSKP
QGTVKAICIRKGAKYLKRKDIESIRKFAADHFNEEVLPIFLKTNENWNSPVAKFIMEEQG
LGLVKLLETQEEDVVLLTAGEHKKACSLMGKLRLECADLLEARGVVLRDPALFSFLWVVD
FPLFLPKEENPQELESAHHPFTAPHPSDIHLLYTEPHKVRSQHYDLVLNGNEIGGGSIRI
HNSELQHCVLDTVLKEDVKLLSHLLQALDYGAPPHGGIALGLDRLMCLVTGAPSIRDVIA
FPKSFRGHDLMSNAPDSIPPEELKPYHIQVSWPMDAETEKSSSNHPCRSES
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgttctgttggttaagtcgactgtgcggggaattatccacacccaccagaaggaccacc
cagttgatctggagttctgccgcccgaagtatggtactgagttcacagagaattccagaa
ctcagtagctttgttgcccggaccaacacatgtggagagttgcgttcttctcacttaggc
caagaagtcaccttatgtggatggattcagtttcgaaggcaaaatatcttcctggtccta
agagatttccatggacttgttcaagttgtcattccccaggatgagtctgctgcttcggtg
aagaagattttatgtgaagctcccatggaatctgtggtgcaagtgtctgggacagtaatt
tcccgacctccaggacaaaagaatccaaaaatgccaacaggtgagattgaaatcaaagtt
aagacagctaaacttctgaattcctgcaagaagctgccctttgaaattaaggactttatg
aagaaaacagagactcttcgtttgcagtaccgctacttagatttgcgtagtgtccaaatg
cagtataacctgcgactgagatcccagatggtcatgaaaatgcgggaatatctctgtaat
ctacatggttttgtggatgtagaaacaccaacattattcaagaggactccagggggtgca
aaagagtttgtaataccatccagggaacctgggaagttttattctctccctcagagtcct
caacagtttaagcagcttctgatggttggtggtctagacagatattttcaggttgcccga
tgttaccgagacgaaggttcaagaccagacagacagcctgaatttactcagatcgacata
gagatgtcctttgtagaccagacgggcgtccagagtctaattgagggcttgctccagtat
tcgtggcccagtgacaaagatcctctggtggtcccttttccttccatgccttttgctgag
gcactggccagctatggaaccgataaacctgacactcgctttgggatgaagattgtagat
atcagtgacatgttcagaaacacagaagttggatttctccaagatgcccttagtaaaccc
caaggaactgtcaaagccatatgtatccgtaaaggagcaaaatatttgaaaaggaaggac
attgaatccattagaaaatttgcagctgaccattttaatgaggaagtcttacctatattc
ctgaaaaccaatgaaaactggaattctccagttgctaagttcataatggaggagcaaggc
ttgggactcgtcaaactgttggagacccaagaggaggacgtggtcctgctcactgccgga
gagcacaagaaagcatgctctttgatgggaaaattacgactggagtgtgctgaccttcta
gaagcaagaggagtggtgcttcgtgaccccgctctgttctctttcctttgggtggtggat
ttccccctcttccttcccaaggaggaaaatccccaagagctggagtcagcccaccaccca
tttactgctccccatccgagtgacattcaccttctttacactgagccccacaaggtccgt
agccaacactatgacttggttttaaacggcaatgagataggaggtggttctatccgaatt
cataattcagagcttcagcattgcgtcctggacacagtactaaaggaagatgtgaaattg
ctctcccatctgctccaggctttagattatggggcgccccctcatggaggaattgcctta
gggttagacagactgatgtgccttgtcactggagcaccaagcatcagagatgtcatagcc
ttccccaaatccttccgggggcacgatctcatgagcaatgccccagattctatccctcct
gaggaactgaagccctatcacatccaggtctcctggccaatggatgcagaaacagaaaag
agctcatcgaatcatccatgccgttcagaaagttga

DBGET integrated database retrieval system