KEGG   Bos taurus (cow): 538967
Entry
538967            CDS       T01008                                 

Gene name
CDC42EP3
Definition
(RefSeq) cdc42 effector protein 3
Organism
bta  Bos taurus (cow)
SSDB
Motif
Pfam: BORG_CEP PBD
Other DBs
NCBI-GeneID: 538967
NCBI-ProteinID: NP_001039909
BGD-bta: BT18117
Ensembl: ENSBTAG00000023736
VGNC: 27074
UniProt: Q2KI46
Position
11
AA seq 254 aa
MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIGKEGQHDVFGDISFLQ
GNYELLPGNQEKAHMGQFPGHNEFFRANSTSDSMFTETPSPVLKNAISLPTIGGSQALML
PLLSPVTFSSKQESFGPGKLPRLSCEPVVEEKVPEKSSVLENGTVHQADVSWGSSGSASQ
SSQGRDSHSSSLSEQYPDWAAEDMFDHPAPCELVKEKTKSEESLSDLTGSLLSLQLDLGP
SFLDEVLNVMDKNK
NT seq 765 nt   +upstreamnt  +downstreamnt
atgccagccaaaaccccgatttacctgaaagctgccaataacaagaaaggaaagaaattt
aaactgagggacatcttgtctcccgatatgataagtccgcccctcggagacttccgccac
accattcacatcggcaaggagggccagcacgacgtcttcggagacatttcctttctccaa
ggcaactatgagcttctacccggaaaccaggagaaagcacacatgggccagttccctggg
cataatgagttcttccgggccaacagcacctccgactccatgttcacagaaacgccctcg
ccggtgctcaaaaacgccatctctctcccgaccatcggagggtcccaagccctcatgttg
cccttgttgtccccggtgacattcagttccaagcaggagtcctttgggccgggaaagctg
ccccggcttagctgtgagccggtcgtggaggagaaggttccagagaaaagcagtgtgttg
gagaacgggacggtccaccaggcggacgtctcatgggggtcgagcgggtctgcatcgcag
tccagccaggggcgggacagccactcctccagcctgtccgaacagtaccccgactgggcc
gcggaggacatgtttgaccatcccgccccttgcgagctcgtcaaggaaaagactaaatca
gaggagtccctctctgacctcacgggttccctcctgtccctgcagcttgatctcgggccc
tcctttctggatgaggtgctgaatgtcatggataaaaataagtaa

DBGET integrated database retrieval system