KEGG   Bos taurus (cow): 539003Help
Entry
539003            CDS       T01008                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta-1
  KO
K02105  catenin beta 1
Organism
bta  Bos taurus (cow)
Pathway
bta04015  Rap1 signaling pathway
bta04310  Wnt signaling pathway
bta04390  Hippo signaling pathway
bta04510  Focal adhesion
bta04520  Adherens junction
bta04550  Signaling pathways regulating pluripotency of stem cells
bta04670  Leukocyte transendothelial migration
bta04916  Melanogenesis
bta04919  Thyroid hormone signaling pathway
bta04934  Cushing syndrome
bta05100  Bacterial invasion of epithelial cells
bta05160  Hepatitis C
bta05163  Human cytomegalovirus infection
bta05165  Human papillomavirus infection
bta05167  Kaposi sarcoma-associated herpesvirus infection
bta05200  Pathways in cancer
bta05205  Proteoglycans in cancer
bta05210  Colorectal cancer
bta05213  Endometrial cancer
bta05215  Prostate cancer
bta05216  Thyroid cancer
bta05217  Basal cell carcinoma
bta05224  Breast cancer
bta05225  Hepatocellular carcinoma
bta05226  Gastric cancer
bta05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
bta05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    539003 (CTNNB1)
   04310 Wnt signaling pathway
    539003 (CTNNB1)
   04390 Hippo signaling pathway
    539003 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    539003 (CTNNB1)
   04520 Adherens junction
    539003 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    539003 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    539003 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    539003 (CTNNB1)
   04916 Melanogenesis
    539003 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    539003 (CTNNB1)
   05205 Proteoglycans in cancer
    539003 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    539003 (CTNNB1)
   05225 Hepatocellular carcinoma
    539003 (CTNNB1)
   05226 Gastric cancer
    539003 (CTNNB1)
   05216 Thyroid cancer
    539003 (CTNNB1)
   05217 Basal cell carcinoma
    539003 (CTNNB1)
   05215 Prostate cancer
    539003 (CTNNB1)
   05213 Endometrial cancer
    539003 (CTNNB1)
   05224 Breast cancer
    539003 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    539003 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    539003 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    539003 (CTNNB1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    539003 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    539003 (CTNNB1)
   05163 Human cytomegalovirus infection
    539003 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    539003 (CTNNB1)
   05165 Human papillomavirus infection
    539003 (CTNNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Motif
Other DBs
NCBI-GeneID: 539003
NCBI-ProteinID: NP_001069609
BGD-bta: BT22729
Ensembl: ENSBTAG00000016420
VGNC: 27802
UniProt: Q0VCX4
Position
22
AA seq 781 aa AA seqDB search
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atggctacccaagctgatttgatggagctggacatggccatggagccagacagaaaagca
gccgtcagtcactggcagcagcagtcttacctggactctggaatccattctggtgccacc
accacagctccttctctgagcggtaaaggcaatcctgaggaagaggatgtggataccacc
caagtcctgtatgagtgggaacaggggttttctcagtccttcactcaagaacaagtagct
gatattgatggacagtatgcaatgactcgagctcagagggtgagagctgctatgttccct
gagacgctagatgagggcatgcagatcccatctacacagtttgatgccgctcatcccact
aacgtccagcgtctggctgaaccatcacagatgctgaaacatgcagttgtaaacttaatt
aactatcaagatgatgcagaacttgccacacgtgcaatccctgaattgacaaaactgctg
aatgatgaggaccaggtggtggttaataaggctgcagttatggtccatcagctttctaaa
aaggaagcttcgagacacgccatcatgcgttctcctcagatggtgtctgctatcgtacgc
accatgcagaacacaaatgacgtggagacagctcgctgcactgctgggaccttgcacaat
ctttcccaccatcgtgagggcttgctggccatctttaaatctgggggcattcctgccctg
gtgaagatgctcggttcaccagtggattctgtattgttttatgccattacaactctccac
aaccttttattgcatcaggaaggagctaaaatggccgtgcgtttagctggcgggctgcag
aaaatggttgccttgctcaacaaaacgaatgttaaattcttggctattacaacagattgt
cttcagattctagcttatggcaatcaagaaagcaagctcatcatcctggctagtggtgga
cctcaagctctagtgaatataatgaggacctacacttatgagaagctactgtggaccaca
agcagagtgctgaaggtgctgtctgtctgctccagtaacaagccggctattgtagaagct
ggtggaatgcaagctttaggacttcacctgacagatccaagtcagcgccttgttcagaac
tgcctttggactctaaggaatctttcagatgctgcaactaaacaggaagggatggaaggt
cttcttgggactcttgttcagcttctgggctcagatgatatcaatgtggtcacctgtgca
gctggaattctttctaatctcacttgcaataattataagaacaagatgatggtgtgccaa
gtgggtggcatagaggcccttgtgcgcacggtcctccgtgctggggacagggaagacatc
actgagcctgccatctgtgcccttcgtcatctgaccagccggcaccaggaggctgagatg
gcccagaacgctgttcgccttcactacgggctacctgtggtggttaaactcctacatcca
ccatcccactggcctctgatcaaggctactgttggattgattcgaaatcttgccctttgt
ccagcaaatcatgcacctttgcgtgagcagggtgccattccacgactagttcagttgctg
gttcgtgcacatcaggatacccagcgtcgtacatctatgggtggaacacagcagcagttt
gtggagggagtccgcatggaagaaatagttgaaggttgtactggagcccttcacatccta
gctcgggatgttcacaaccgaatcgttatcagaggactaaataccattccattgtttgtg
cagctgctttattctcctattgaaaatatccaaagagtagctgcaggggtcctctgtgaa
cttgctcaggacaaggaagctgcagaagctattgaagccgagggagccacagctcctctg
acagaattacttcattctaggaatgaaggtgtggcaacatatgcagctgctgttttgttc
cgaatgtctgaggacaagccacaggattataagaaacggctttcggttgagctgaccagt
tctctcttcagaacggagccaatggcttggaatgagactgctgatcttggacttgatatt
ggtgcccagggagaacctcttggatatcgccaggatgatcccagctatcgttcttttcac
tctggtgggtacggccaggacgccttggggatggaccccatgatggaacatgagatgggc
ggccaccaccctggtgctgactatccagttgacgggctgccagatctggggcatgcccag
gacctcatggatgggctgcccccgggcgacagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system