KEGG   Bos taurus (cow): 539051
Entry
539051            CDS       T01008                                 

Gene name
TUB
Definition
(RefSeq) tubby protein homolog
Organism
bta  Bos taurus (cow)
SSDB
Motif
Pfam: Tub Tub_N DUF3527 BSP_II Na_trans_assoc
Other DBs
NCBI-GeneID: 539051
NCBI-ProteinID: NP_001179089
BGD-bta: BT23036
Ensembl: ENSBTAG00000004862
VGNC: 36503
UniProt: A0A3Q1MQM7
Position
15
AA seq 508 aa
MTSKPHSDWIPYSVLDDEGSNLRQQKLDRQRALLEQKQKKKRQEPLMVQANADGRPRSRR
ARQSEEQAPLVESYLSGSTGYQVQEADSLASVPLGTAHPTAPASAKRTKAAAAAGGQGGA
SRKERKGKHKGSGGPAALAEDKSEARGPVQILTVGQSDQAQDAGETATGGGTRPGGQDIR
ATMQRKGISSSMSFEEEEEEEEEEEDENSSSSSQLNSNTRPSSATSRKSTREAASAPSPT
APEPSVDVEVQDLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLHLDREDGKKVFL
LAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGVNPQKASASTL
ESGTLRQELAAVCYETNVLGFKGPRKMSVIVPGMTMVHERVSIRPRNEHETLLARWQNKN
TESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHGNDPDYIVMQFGRVAEDVF
TMDYNYPLCALQAFAIALSSFDSKLACE
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgacttccaagccgcattccgactggattccctacagtgtcttagatgatgagggcagc
aacctgcggcagcagaagcttgataggcagcgggccctgctggagcagaagcagaagaag
aagcgccaggagcccctgatggtgcaggccaatgccgacgggcggcccaggagccggcgg
gcccggcagtcggaggagcaggcccccctggtggagtcctacctcagcggcagcaccggc
taccaagttcaagaggccgactcgcttgccagtgtgcccctgggaactgcccaccccaca
gcaccagcctcagccaagagaaccaaggcggccgccgcggcagggggccagggcggggcc
tctaggaaggagaggaaggggaagcacaaaggctccggcgggccagcagcactggctgaa
gacaagtctgaggcccgaggccctgtgcagatcctgactgtgggccagtcggaccaggcc
caggacgcaggggagacggccacaggtggcggcacacggcccggtgggcaggacatccgt
gccacgatgcagaggaagggcatctccagcagcatgagcttcgaggaggaggaggaggag
gaggaggaggaggaggacgagaacagctccagctcctcccagctgaatagcaacacccgc
cccagctccgccacgagcaggaagtccaccagggaggcagcctcggcccccagccccaca
gcccccgagccgtcggtggatgttgaggtccaggatctcgaagagtttgccctgaggccg
gccccccaggggatcaccatcaagtgccgcatcacacgggacaagaagggcatggaccgg
ggcatgtaccccacctacttcctgcacctggaccgtgaggacgggaagaaggtgttcctc
ctggcgggaaggaagagaaagaagagtaaaacttccaattacctcatctccgtggaccct
acagacttgtctagaggaggggacagctacatcgggaaactgcggtccaacctcatgggc
accaagttcaccgtgtatgacaatggagtcaaccctcagaaagcatcagcctctactttg
gaaagtggaaccttgcgtcaggagctggctgctgtctgctatgagacaaacgtcttaggt
tttaaggggcctcggaagatgagtgtgattgtcccgggcatgaccatggttcatgagaga
gtctccatccggccccgcaacgagcatgagacgctgctagcacgctggcagaacaagaac
acagagagtatcatcgagctgcaaaacaagacgcccgtctggaacgacgacacgcagtcc
tacgtactcaacttccacgggcgcgtcactcaggcctcggtgaagaacttccagatcatc
cacggcaatgacccggactacatcgtgatgcagtttggccgcgtagcagaggacgtgttc
accatggattacaactacccgttgtgtgcgctgcaggcctttgccattgccctgtccagc
ttcgacagcaagctggcctgcgagtag

DBGET integrated database retrieval system