KEGG   Bos taurus (cow): 539149
Entry
539149            CDS       T01008                                 

Symbol
TUBB4B
Name
(RefSeq) tubulin beta-4B chain
  KO
K07375  tubulin beta
Organism
bta  Bos taurus (cow)
Pathway
bta04145  Phagosome
bta04540  Gap junction
bta05010  Alzheimer disease
bta05012  Parkinson disease
bta05014  Amyotrophic lateral sclerosis
bta05016  Huntington disease
bta05020  Prion disease
bta05022  Pathways of neurodegeneration - multiple diseases
bta05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:bta00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    539149 (TUBB4B)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    539149 (TUBB4B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    539149 (TUBB4B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    539149 (TUBB4B)
   05012 Parkinson disease
    539149 (TUBB4B)
   05014 Amyotrophic lateral sclerosis
    539149 (TUBB4B)
   05016 Huntington disease
    539149 (TUBB4B)
   05020 Prion disease
    539149 (TUBB4B)
   05022 Pathways of neurodegeneration - multiple diseases
    539149 (TUBB4B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bta03036]
    539149 (TUBB4B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bta04812]
    539149 (TUBB4B)
   04147 Exosome [BR:bta04147]
    539149 (TUBB4B)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     539149 (TUBB4B)
Cytoskeleton proteins [BR:bta04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    539149 (TUBB4B)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   539149 (TUBB4B)
  Exosomal proteins of colorectal cancer cells
   539149 (TUBB4B)
  Exosomal proteins of bladder cancer cells
   539149 (TUBB4B)
SSDB
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Other DBs
NCBI-GeneID: 539149
NCBI-ProteinID: NP_001029835
BGD-bta: BT11713
Ensembl: ENSBTAG00000025274
VGNC: 36508
UniProt: Q3MHM5
Position
11
AA seq 445 aa
MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYV
PRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEGEFEEEAEEEVA
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgagggagatcgtgcacctgcaggccggccagtgcggcaaccagatcggcgccaagttt
tgggaggtgatcagcgacgagcatggcatcgatcctaccggcacctaccacggggatagc
gacctgcagctggagcgaatcaacgtgtactacaacgaggccaccggtggcaagtatgtg
ccccgcgcggtgctcgtggacctggagccgggcaccatggactctgtgcgctcgggccct
ttcgggcagatcttcaggccggacaactttgtcttcggtcagagcggggccgggaacaac
tgggccaaggggcactacacggaaggcgcagagctcgtcgactcggtgctggacgtcgtg
aggaaggaggcggagagctgtgactgcctgcagggcttccagctgacccactccttgggt
ggggggactgggtctgggatgggcaccctcctcatcagcaagattcgggaggagtatcca
gacaggatcatgaacactttcagcgtggtgccctcgcccaaagtgtcagacaccgtcgtg
gagccctacaacgccaccctctcagtccaccagctcgtagagaacacagacgagacctac
tgcattgacaacgaggcgctgtacgacatctgcttccgcaccctgaagctgaccaccccc
acctacggggacctgaaccacctggtgtcggccaccatgagcggggtcaccacctgcctg
cgcttcccgggccagctcaacgctgacctgcgcaagctggctgtcaacatggtccccttc
ccccgcctgcacttcttcatgcccggctttgccccgctaaccagccggggcagccagcag
taccgggcactgacggtgcccgagctcacccagcagatgtttgacgccaagaacatgatg
gccgcctgcgacccacgccacggccgctacctgaccgtggccgccgtcttccggggccgc
atgtccatgaaggaggtggacgagcagatgctcaacgtgcagaacaagaacagcagctac
ttcgtggagtggatccccaacaacgtgaagacggccgtgtgcgacatcccgccccgcggc
ctgaagatgtcggccaccttcatcggcaacagcacggccatccaggagctgttcaagcgc
atctcggagcagttcacggccatgttccggcgcaaggccttcctgcactggtacacgggc
gagggcatggacgagatggagttcaccgaggccgagagcaacatgaacgacctggtgtcc
gagtaccagcagtaccaggacgccacggccgaggaagagggcgagttcgaggaggaggcg
gaggaggaggtggcctag

DBGET integrated database retrieval system