KEGG   Bos taurus (cow): 539196Help
Entry
539196            CDS       T01008                                 

Gene name
RPS11
Definition
(RefSeq) 40S ribosomal protein S11
  KO
K02949  small subunit ribosomal protein S11e
Organism
bta  Bos taurus (cow)
Pathway
bta03010  Ribosome
Module
bta_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:bta00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    539196 (RPS11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bta03011]
    539196 (RPS11)
Ribosome [BR:bta03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    539196 (RPS11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S17_N Ribosomal_S17 PRF
Motif
Other DBs
NCBI-GeneID: 539196
NCBI-ProteinID: NP_001019739
BGD-bta: BT24496
Ensembl: ENSBTAG00000013924
VGNC: 53041
UniProt: Q3T0V4
Position
18
AA seq 158 aa AA seqDB search
MADIQTERAYQKQPTIFQNKKRVLLGETGKEKLPRYYKNIGLGFKTPKEAIEGTYIDKKC
PFTGNVSIRGRILSGVVTKVKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPCFRDV
QIGDIVTVGECRPLSKTVRFNVLKVTKAAGTKKQFQKF
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggcggacattcagacagaacgtgcgtaccaaaagcaaccgaccatctttcaaaataaa
aagagggtcctgcttggagaaactggcaaagaaaagctccctcgatactacaagaacatt
ggtctgggcttcaagactccaaaggaggccatcgagggcacctacattgacaagaaatgc
ccttttacgggtaatgtctccattcgagggcggatcctgtctggcgtggtgaccaaagtg
aagatgcagaggaccatcgtcatccgccgagactaccttcactacatccgaaagtacaac
cgctttgagaagcgccacaagaacatgtccgtgcacctttctccctgcttcagggacgtc
cagatcggcgacatcgtcacggtgggcgagtgccggcccctgagcaagactgtgcgcttc
aatgtcctcaaggtcaccaaggctgccggcaccaagaagcagttccagaagttctga

DBGET integrated database retrieval system