KEGG   Bos taurus (cow): 539534Help
Entry
539534            CDS       T01008                                 

Gene name
S1PR4
Definition
(RefSeq) sphingosine 1-phosphate receptor 4
  KO
K04293  sphingosine 1-phosphate receptor 4
Organism
bta  Bos taurus (cow)
Pathway
bta04068  FoxO signaling pathway
bta04071  Sphingolipid signaling pathway
bta04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    539534 (S1PR4)
   04071 Sphingolipid signaling pathway
    539534 (S1PR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    539534 (S1PR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bta04030]
    539534 (S1PR4)
G protein-coupled receptors [BR:bta04030]
 Rhodopsin family
  Lipid
   Sphingolipid
    539534 (S1PR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srv 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 539534
NCBI-ProteinID: XP_005209070
BGD-bta: BT28972
Ensembl: ENSBTAG00000000381
VGNC: 34255
Position
7
AA seq 385 aa AA seqDB search
MNATGTPTGDPESCQLLAAGGHSRLIVLHYNHSGRLAGRAGAEEVGLGVLRGLFVAVSCL
VVLENMLVLVAIASRMRSRRWVYYCLVNITLSDLLTGAAYLANVLLSGAHTFRLAPSQWF
LREGLLFMALAASTFSLLFTAGERFATMVRPVAESGATKRGRVCSFIGLCWLLAALLGLL
PLLGWNCVCAFQRCSSLLPLYSKDYILFCVVVFACILATIMVLYGAIFRVVRANGQKAPS
IPARRKAQRLLKTVLMILVAFVVCWGPLFGLLLADIFGSNVWAQEYLRGMDWILALAVLN
SAVNPIIYSFQSREVCRAVVGFLCGACLRLGLRGPGDCLAQAVEAHSAASNTDSSLRPRD
SFRGSRSHSFRMREPLTSVSSVRSV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccacggggaccccgacgggggaccccgagtcctgccagctgctggcggccggt
gggcacagccggctcatcgtcctgcactacaaccactcggggcggctggcggggcgcgcc
ggggcggaggaggtcggcctgggggtgcttcgagggctgttcgtggccgtgagctgcctg
gtggtgctggaaaacatgctggtgctggtggccattgccagccgcatgcgctcccggcgc
tgggtctactactgcctcgtgaacatcacgctcagcgacctgctcaccggcgccgcgtac
ctggctaacgtgctgctgtcgggggcgcacaccttccgcctggcgccgtcccagtggttc
ctgcgcgagggcctgctcttcatggcgctggccgcctccaccttcagcctgctcttcacg
gccggcgagcgtttcgccaccatggtgcggccggtggccgagagcggggccaccaagcgg
ggccgcgtgtgcagcttcatcgggctgtgctggctgctggcggcgctcctcggcctgctg
cccctgctcggctggaactgcgtgtgcgccttccaacgttgctccagtctcctcccgctc
tactccaaggactacatcctcttctgcgtagtggtcttcgcttgcatcctggccaccatc
atggtgctctacggggccatcttccgagtggtgcgcgccaatgggcagaaggcgcccagc
atcccggcgcgccgcaaggcccaacggctgctcaagacggtacttatgattctggtggcc
ttcgtggtgtgctggggcccgcttttcggcctgctgctggccgatatcttcggctccaac
gtctgggcgcaggagtacctgaggggcatggactggatcctggcactggccgtgctcaac
tcggcggtcaaccctatcatctactccttccaaagccgggaggtgtgccgggccgtggtg
ggcttcctgtgcggtgcatgtctccggctagggcttcgagggcctggggactgcctggct
caggccgtcgaggcccactctgcagcctccaacaccgacagctcactgaggccgagggac
agctttcggggttctcgatcgcacagcttccggatgcgggagcccctgaccagtgtctct
agcgtgcggagtgtctga

DBGET integrated database retrieval system