KEGG   Bos taurus (cow): 540179
Entry
540179            CDS       T01008                                 

Gene name
GPC4
Definition
(RefSeq) glypican-4 precursor
  KO
K08110  glypican 4
Organism
bta  Bos taurus (cow)
Pathway
bta04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    540179 (GPC4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:bta00535]
    540179 (GPC4)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bta00537]
    540179 (GPC4)
Proteoglycans [BR:bta00535]
 Cell surface proteoglycans
  Glypican family (GPI-anchored HSPG)
   540179 (GPC4)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bta00537]
 Others
  540179 (GPC4)
SSDB
Motif
Pfam: Glypican DUF1910 DUF4422 Corona_6B_7B Serglycin
Other DBs
NCBI-GeneID: 540179
NCBI-ProteinID: NP_001192713
BGD-bta: BT11641
Ensembl: ENSBTAG00000020644
VGNC: 29526
UniProt: F1MCX1
Position
X
AA seq 556 aa
MARFGLPALFCTLAALSAALLAAEPKSKSCSEVRRLYVSKGFDKNDAPMHEINGDHLKIC
LQGYTCCSQEMEEKYSLQSKEDFKSVVSEQCNHLQAVFASRYKKFDEFFKELLENAEKSL
NDMFVKTYGHLYMQNSELFKDLFEELKRYYVAGNVNLEEMLNDFWARLLERMFRLVNSQY
HFTDEYLECVSKYTEQLKPFGDVPRKLKLQVTRAFVAARTFAQGLAVARDVVSKVSVVNP
TTQCTHALVKMMYCSHCQGLVTVKPCYNYCSNIMRGCLANQGDLDLEWNNFIDAMLMVAE
RLEGPFNIESVMDPIDVKISDAIMNMQENSVQVSQKVFQGCGPPKPLPAGRISRSISEGT
FSARFRPFHPEERPTTAAGTSLDRLVTDVKEKLKQAKKFWSSLPSSVCNDERMAAGSGNE
DDCWNGKGQSRYLFAVTGNGLANQGNNPEVQVDTSKPDILILRQVMALRVMTSKMKNAYN
GNDVDFFDISDESSGEGSGSGCESQQCPSEFEYNATDHSGKSANDKASSAGVPAAAWPYL
LPVFCILSLVMQREWR
NT seq 1671 nt   +upstreamnt  +downstreamnt
atggcacggttcggcttgcccgcgctgttctgcaccctggccgcgctcagcgccgcactg
ctggctgccgagcccaagtcgaaaagttgctcggaagtgcgacgtctctacgtgtccaaa
ggcttcgacaagaacgatgcccccatgcacgagatcaacggtgatcatttgaaaatctgt
ctccagggttatacctgctgctctcaagagatggaggaaaagtacagcctccagagtaag
gaggatttcaaaagtgtggtcagtgaacagtgcaatcatttacaagctgtctttgcctcc
cgctacaagaagtttgatgaattcttcaaagaactacttgaaaatgcggaaaagtccctg
aatgacatgtttgtgaagacatacggccacttgtacatgcagaattctgagctatttaaa
gatctcttcgaagagttgaagcgctactatgtggcagggaacgtgaacctggaggaaatg
ctgaatgacttctgggcccgcctcctggagcgcatgtttcgcctggtgaactcccagtac
cacttcacagacgaatatctggagtgcgtgagcaagtacacagagcagctgaagcccttt
ggagatgtccctcggaaactgaagctccaggtcactcgtgcatttgtggcagcccgcact
tttgctcagggcttagcagttgcaagagatgtggtgagcaaagtctcagtggtgaatccc
acaacccagtgtacccatgccctggtgaagatgatgtactgctcccactgccaaggtctc
gtgactgtgaaaccctgttacaactattgctccaacatcatgagaggctgtttggccaac
caaggggatcttgatctcgagtggaacaatttcatagatgctatgctgatggtggctgag
aggctggagggtcctttcaacattgagtccgtcatggatcccatcgacgtgaagatatca
gatgctattatgaacatgcaggagaacagtgtgcaggtatctcagaaggttttccaggga
tgtggaccccccaagcccctcccagctggtcggatttcccgttccatctcagaaggcacc
ttcagtgcccgcttcaggcccttccatcccgaggagcgccccaccacagcagctggcacc
agtttggaccgattggttactgatgtcaaggagaaactgaagcaggccaagaagttctgg
tcctctcttcctagcagtgtctgcaatgatgagaggatggctgcagggagcggcaatgag
gatgattgctggaacgggaaaggccaaagcaggtacttgtttgctgtgacaggaaatggt
ctagccaaccagggcaataatccagaggtgcaggttgacaccagcaagccggacatactg
atccttcgtcaagtcatggctcttcgagttatgaccagtaagatgaagaatgcttacaat
gggaacgatgtggacttctttgatatcagtgacgaaagcagtggagaaggaagtggtagc
ggatgtgagtctcagcagtgtccttcggagtttgagtataatgcaactgaccactctggg
aagagtgccaatgataaagccagcagcgctggggtccccgctgcggcctggccctacctc
ctccctgtcttctgcatcttatccctggttatgcagagagagtggagataa

DBGET integrated database retrieval system