KEGG   Bos taurus (cow): 540387Help
Entry
540387            CDS       T01008                                 

Gene name
CYSLTR2
Definition
(RefSeq) cysteinyl leukotriene receptor 2
  KO
K04323  cysteinyl leukotriene receptor 2
Organism
bta  Bos taurus (cow)
Pathway
bta04020  Calcium signaling pathway
bta04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    540387 (CYSLTR2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    540387 (CYSLTR2)
G protein-coupled receptors [BR:bta04030]
 Class A. Rhodopsin family
  Other
   Cysteinyl leukotriene
    540387 (CYSLTR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 TAS2R 7TM_GPCR_Srw
Motif
Other DBs
NCBI-GeneID: 540387
NCBI-ProteinID: NP_001095710
BGD-bta: BT26344
Ensembl: ENSBTAG00000017508
VGNC: 50271
UniProt: A7MBH4
Position
12
AA seq 367 aa AA seqDB search
MERKLVSLSPSISASEMETNSTFSDHHSNRNCTAEDFKREFYPIVYLVIFIWGALGNGFS
IYVFVQPYRKSTSVNIFMLNLATSDLLFTATLPFRVDYYLRGSNWIFGDLSCRIMSYSMY
VNMYSSIYFLTVLSVVRFLATVHPFRLLHATSVRNAWIVCGIIWIFIMASSTTLLNNGSE
LKGNVTLCLELNRNKAPKLKTMNYIALVVGFLLPFCTLSICYMLIIRALLKAEVPELGLR
LSHRKALTTIIIALVIFLLCFLPYHILRTLHLLQWTADICRDSLHKAVAITLALAAANSC
FNPLLYYFAGENFKDRLKSALRKDHPQEPKCSFPFCVWLKNETRGTLQESLLLQNKRINQ
DKGKHDI
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaaaacttgtgtccttatctccatccatatccgcatcagaaatggaaaccaac
agcaccttcagcgatcaccatagcaacaggaactgcacagctgaagactttaagagagaa
ttttaccccatcgtgtacctggtaatatttatctggggagccttgggaaatggcttttcc
atatatgttttcgtgcaaccttataggaagtccacatctgtgaacattttcatgctcaat
ctggctacttcagatctcttattcacagccacactgcccttcagggtggactattacctc
agagggtccaattggatatttggggacctgagttgcaggattatgtcttactctatgtat
gtcaacatgtacagcagcatttatttcctgactgtgttgagtgtggtgcgtttcctggca
accgttcaccccttccggctccttcatgccactagcgtcaggaatgcctggattgtttgt
ggcatcatatggatctttatcatggcttcctcaacaacgcttctgaacaatggctctgag
ctgaagggcaatgtcacgttgtgcttggagctgaatcgtaataaagctcctaaactgaag
accatgaactacattgccttggtggtgggctttctgctgcccttctgcacactcagcatc
tgctacatgctgatcattcgagctctgttgaaggcggaggtcccagaattagggctgcgg
ctttctcacaggaaggcattgaccaccatcatcattgccttggtcatcttcctcctgtgt
ttcttgccctatcatatactgagaaccctccacctgctccagtggacggcggatatatgc
agagactcgctgcataaagctgtggccatcacactggctttggcggcagccaacagctgc
ttcaaccctttgctttattactttgctggggagaattttaaggacagactaaagtctgca
ctcaggaaagatcatccacaggaaccaaagtgcagctttcctttctgtgtgtggctgaaa
aacgaaacaagaggaaccctacaggagagtttgcttctccaaaataagagaataaaccaa
gataaaggaaaacatgacatctag

DBGET integrated database retrieval system