KEGG   Bos taurus (cow): 540389Help
Entry
540389            CDS       T01008                                 

Gene name
KRTCAP2
Definition
(RefSeq) keratinocyte-associated protein 2
Organism
bta  Bos taurus (cow)
SSDB OrthologParalogGFIT
Motif
Pfam: Keratin_assoc
Motif
Other DBs
NCBI-GeneID: 540389
NCBI-ProteinID: NP_001094679
BGD-bta: BT30305
Ensembl: ENSBTAG00000010617
VGNC: 30751
UniProt: A6QQ59
Position
3
AA seq 136 aa AA seqDB search
MVVGTGTSLALSSLLSLLLFAGMQMYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLEN
LVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQATA
PVLTPAKVTGKGKKRN
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggtggtgggtacaggcacgtcgctggcgctttcctccctcctgtccctgctgctcttc
gctgggatgcagatgtatagtcgccagctggcctccaccgagtggctcaccatccagggc
ggcctgcttggttccggccttttcgtcttctctctcactgccttcaataatctggagaat
cttgtctttggcaaaggattccaagcaaagatcttccctgagattctcctctgcctcctg
ttggctctctttgcatcaggcctcatccacagagtctgtgtcaccacttgcttcatcttc
tccatggttggtctgtactacatcaacaagatctcttccactctgtaccaggcgacagct
ccagtcctcacgccagccaaggttacaggcaagggcaaaaagagaaattga

DBGET integrated database retrieval system