KEGG   Bos taurus (cow): 540473Help
Entry
540473            CDS       T01008                                 

Gene name
ASCL1
Definition
(RefSeq) achaete-scute homolog 1
  KO
K09067  achaete-scute complex protein
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bta03000]
    540473 (ASCL1)
Transcription factors [BR:bta03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Achaete-Scute
    540473 (ASCL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH
Motif
Other DBs
NCBI-GeneID: 540473
NCBI-ProteinID: XP_002687686
BGD-bta: BT10989
Ensembl: ENSBTAG00000016227
VGNC: 26206
UniProt: E1B7V5
Position
5
AA seq 219 aa AA seqDB search
MESSAKMESGGAGPQPQQPFLPPAACFFATAAAQSAQQPPPPPPPPPQLSPAADGQPSGG
GHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAVARRNERERNRVKLVNLG
FATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNY
SNDMNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggagagctctgccaagatggagagcggcggcgcaggcccgcagccccagcagcccttc
ctaccgcccgcagcctgcttctttgccacggcggcggcacagagcgcgcagcagccgccg
ccgccgccgccgccgccgccacagctgagccccgcggccgacggccagccctcagggggc
ggtcacaagtcagcgcccaagcaagtcaagcgccagcgctcttcgtctcccgaactgatg
cgctgcaaacgccggctcaacttcagcggctttggctacagcctgccgcagcagcagccg
gccgccgtggcgcgtcgcaacgagcgcgagcgcaaccgcgtcaagctggtcaacctgggc
ttcgccacccttcgggagcacgtacccaacggtgcggccaacaagaagatgagcaaggtg
gagacgctgcgctccgccgtcgagtacatccgcgcgctccagcagctgctggacgagcac
gacgcggtgagcgccgccttccaggccggcgtcctgtcgcccaccatctcccccaactac
tccaacgacatgaactccatggccggctcgccggtctcatcctactcttcggacgagggg
tcctacgaccctctcagccccgaggaacaagaactactcgatttcaccaactggttctga

DBGET integrated database retrieval system