KEGG   Bos taurus (cow): 540730
Entry
540730            CDS       T01008                                 
Symbol
ASCL4
Name
(RefSeq) achaete-scute homolog 4
  KO
K09067  achaete-scute complex protein
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bta03000]
    540730 (ASCL4)
Transcription factors [BR:bta03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Achaete-Scute
    540730 (ASCL4)
SSDB
Motif
Pfam: HLH Cas9-BH
Other DBs
NCBI-GeneID: 540730
NCBI-ProteinID: XP_005206856
Ensembl: ENSBTAG00000046402
VGNC: 26208
UniProt: G3MY92
Position
5:71005428..71007793
AA seq 168 aa
MEKRPQDGLLTLPHHLSQVPLGVPRSLPRLLMRDSFRVSVSWEPALGGGGAPRRPYLPLR
LDGAFEPAFLRKRNERERQRVRCVNEGYARLRDHLPREVADRRLSKVETLRAAIGYIKQL
QEVLERHAPGQEGAAGAGSSRRAECNSDGESKASSAPSPSSEPEDGAS
NT seq 507 nt   +upstreamnt  +downstreamnt
atggagaaacgtccacaggacggactgctgaccctgccgcatcacctgagccaggtgcct
ctgggcgtgccgaggtccctgccccgcctcctcatgcgggactccttcagagtctccgtg
agttgggagccggcgctcggcggcggcggcgccccgaggcggccctacctgcccctacgg
ctggacggcgccttcgagcccgccttcctccgcaagcgcaacgagcgcgagcggcagcgg
gtgcgctgcgtgaacgaggggtacgcgcgcctccgagaccacctgccccgagaggtggcg
gacaggcgcctcagcaaagtggagactctccgcgccgccatcggctacatcaagcagctc
caggaggtgctggagcgccacgcaccgggacaggagggtgcggccggtgccggctcctca
cgcagggccgaatgcaacagcgatggcgagtccaaggcctcatcggcgccttcgcccagc
agcgagcccgaggacggggccagctag

DBGET integrated database retrieval system