KEGG   Bos taurus (cow): 540907
Entry
540907            CDS       T01008                                 

Gene name
EPHB3
Definition
(RefSeq) ephrin type-B receptor 3 precursor
  KO
K05112  Eph receptor B3 [EC:2.7.10.1]
Organism
bta  Bos taurus (cow)
Pathway
bta04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    540907 (EPHB3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bta01001]
    540907 (EPHB3)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     540907 (EPHB3)
Protein kinases [BR:bta01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   540907 (EPHB3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 EphA2_TM SAM_1 SAM_2 Ephrin_rec_like Pur_ac_phosph_N fn3_2 Cadherin_C_2 Interfer-bind
Other DBs
NCBI-GeneID: 540907
NCBI-ProteinID: NP_001179725
BGD-bta: BT22730
Ensembl: ENSBTAG00000005313
VGNC: 28539
UniProt: F1ML02
Position
1
AA seq 997 aa
MARARPPPLPPLPPGLLPLLSPLLLLPLLLPAGCRALEETLMDTKWVTSELAWTSHPESG
WEEVSGYDEAMNPIRTYQVCNVRESSQNNWLRTGFIWRRDVQRVYVELKFTVRDCNSIPN
IPGSCKETFNLFYYEADSDVASASSPFWMENPYVKVDTIAPDESFSRLDAGRVNTKVRSF
GPLSKAGFYLAFQDQGACMSLISVRAFYKKCASTTAGFALFPETLTGAEPTSLVIAPGTC
IANAVEVSVPLKLYCNGDGEWMVPVGACTCATGHEPAAKESQCRPCPPGSYKAKQGEGPC
LPCPPNSRTTSPAAGICTCHNNFYRADSDSADSACTTVPSPPRGVISNVNETSLILEWSE
PRDLGGRDDLLYNVICKKCHGGPGTMTCSRCDDNVEFVPRQLGLTERRVHVSHLLAHTRY
TFEVQAVNGVSGKSPLPPRYAAVNITTNQAAPSEVPTLRLHSSSGSSLTLSWAPPERPNG
VILDYEMKYFEKSEGIASTVTSQKNSVQLDGLRPDARYVVQVRARTVAGYGQYSHPAEFE
TTSERGSGAQQLQEQLPLIVGSATAGLVFVVAVVVIAVVCLRKQRHSSDSEYTEKLQQYI
APGMKVYIDPFTYEDPNEAVREFAKEIDVSCVKIEEVIGAGEFGEVCRGRLKQPGRREVF
VAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCALDS
FLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSR
FLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWD
MSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNAAS
LKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMT
AEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQV
NT seq 2994 nt   +upstreamnt  +downstreamnt
atggcccgagcccgcccgccgccgctgccgcccctgccgccggggctcctgccgctgctc
tctccgttgctgctgctgcccctgctgctgcccgccggctgccgggcgctggaagagacc
ctcatggatacaaaatgggtgacatctgagttggcatggacctctcatccggaaagtggg
tgggaagaggtgagcggctatgatgaagccatgaaccccatccgtacgtaccaggtgtgt
aacgtgcgggagtccagccagaacaactggcttcgcacagggttcatctggcggcgagat
gtgcagcgggtctacgtggagctcaagttcactgtgcgggactgcaatagcattcccaac
atccctggctcctgcaaggagaccttcaacctcttctactatgaggctgacagtgacgtg
gcctcagcctcctcccccttctggatggagaacccctatgtgaaggtggacaccatcgca
ccggatgagagcttctcccggctcgatgctggccgtgtcaacaccaaggtgcgcagcttt
gggccgctctccaaggctggcttctacttggccttccaggaccagggcgcctgcatgtcg
ctcatctccgtgcgcgcattctacaagaagtgtgcgtccaccaccgcaggctttgcactc
ttccctgagaccctcactggggctgagcccacctcactggtcatcgcccctggcacctgc
attgccaatgccgtggaggtgtctgtgcccctcaagctctactgcaacggtgacggggag
tggatggtgcctgttggcgcctgtacctgtgccaccggccacgagccagccgccaaggag
tcccagtgccgcccctgtccccccgggagctacaaggcaaagcagggagaagggccctgc
ctgccctgtccacccaatagccgcaccacttcaccagccgctggcatctgcacctgccat
aacaacttctaccgcgcagactccgactccgcagacagtgcctgtaccacggtgccatct
ccgccccggggtgtgatctctaatgtgaatgagacctcactgatccttgagtggagtgag
ccccgggacctgggtggccgggacgacctcctctacaatgtcatctgcaagaagtgccac
gggggccccgggaccatgacctgctcacgctgtgatgacaacgtggagtttgtgcctcgg
cagctgggcctgaccgagcgacgggtgcacgtcagccacctgctggcccacacgcgctac
accttcgaggtgcaggcggtcaatggtgtttcgggcaagagccctctgcccccccgctac
gcagctgtgaatatcaccaccaaccaggctgccccctccgaagtgccgacactacgcctg
cacagcagctccgggagcagcctgaccctgtcctgggcacccccagagcggcccaatgga
gtcatcctggactacgagatgaagtactttgagaagagtgagggcatcgcctccaccgtg
accagccagaagaactccgtgcagctggacgggctgcggcccgatgcccgctatgtggtc
caggtccgagcccgcacggtagctggctatgggcaatacagccacccagctgagtttgag
accacaagcgagagaggctccggtgcccagcagctccaggagcaactccccctcatcgtg
ggctcagccacggctgggctggtcttcgtagtggctgtggtggtcattgctgtcgtctgc
ctcaggaagcagcggcacagctctgattcagagtatacggagaagctgcagcaatacatt
gctcctggaatgaaggtttatatcgacccctttacctatgaagaccctaatgaggccgtg
cgggaatttgctaaggagattgatgtgtcctgcgtcaagattgaggaggtgattggagct
ggggagtttggagaagtgtgccggggtcggctgaaacagcctggccgccgggaggtgttt
gtggccatcaagaccctgaaggtgggttacacggagaggcagcggcgggacttcctcagc
gaggcctccatcatgggtcagtttgaccaccccaacataatccggctggagggcgtggtc
accaaaagtcggccagtcatgatcctcacggagttcatggagaactgcgccctggactcc
ttccttcggctcaacgatggacagttcacggtcatccagctggtgggcatgttgcgaggc
attgctgctggcatgaagtacctgtctgagatgaactatgtgcatcgagacctggctgcc
cgcaacatcctcgtcaacagcaacctggtctgcaaagtctcagacttcggcctctcccgc
ttcttggaggatgacccctctgatcccacctacaccagctccctgggcgggaagatcccc
atccgctggaccgccccagaggccatagcctatcggaagttcacctctgctagtgacgtc
tggagctatggcattgtcatgtgggaggtcatgagctatggcgagcgaccctactgggac
atgagcaaccaggatgtcatcaatgccgtggagcaggattaccggctgcccccacccatg
gactgccccacagcactgcaccagcttatgctggactgctgggtgcgggaccggaacctc
aggcccaaattctcccagatcgtcaacaccctggacaagctcattcgtaatgctgccagc
cttaaagtcatcgccagtgcccagtctggcatgtcacaacccctcctggaccgcacggtc
cccgactacaccaccttcacgacagttggtgactggctagatgccatcaagatggggcgg
tacaaggagagctttgtcagcgcggggtttgcatcctttgacctggtggcccagatgact
gcagaagacctgctccggattggggtcaccttggcgggccaccagaagaagatcctcagc
agtatccaggacatgcggctgcagatgaaccagacgctgcctgtgcaggtctga

DBGET integrated database retrieval system