KEGG   Bos taurus (cow): 541067Help
Entry
541067            CDS       T01008                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform 1 precursor
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
bta  Bos taurus (cow)
Pathway
bta00010  Glycolysis / Gluconeogenesis
bta00562  Inositol phosphate metabolism
bta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    541067 (MINPP1)
   00562 Inositol phosphate metabolism
    541067 (MINPP1)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     541067 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     541067 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 541067
NCBI-ProteinID: NP_001033664
Ensembl: ENSBTAG00000005928
VGNC: 31480
UniProt: F1N1D8
Position
26
AA seq 486 aa AA seqDB search
MPRGPCSLVRVSATPVAVLAVALVSSLSRCSLLEPENSVVSALSPYFGTKTRYEDANPGL
LPDPEVPRRDPELLEETCTPVQLVALIRHGTRYPTTKQIRKLRQLHGLLQARGAEDDRTR
AAGRGDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLQLV
TSSKHRCVDSGAAFLQGLWQHYHPGLPPPDIADMECGPPRINDKLMRFFDHCEKFLTQVE
RNATALYHVEAFKTGPEMQNILKKVADILQVPVNNLNADLIQVAFFTCSFDLAIKGVKSP
WCDVFDIDDAKVLEYLNDLKQYWKRGYGYSINSRSSCTLFQDIFQHLDKAVKQKQRSQPV
SSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKEQMHRKFRSGHIVPYASNLIFVLY
HCKNAKTPKEEFRVQMLLNEKVLPLAHSQETVSLYEDLKNHYKDILQSCHTSEECELPKV
NTSDEL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcggcccgtgcagcctcgtcagggtctccgcaacgcccgtcgcggtcctggct
gtggcgctggtctcgtcgctctctcgctgctccctcctggagccggagaacagtgtggtt
tccgcgctcagcccctactttggcaccaagactcgctacgaggatgccaaccccgggctg
ctgccggaccccgaagtgccgcggcgggacccggagttgttagaggagacctgcaccccg
gtgcaactggtcgccctcatccgccatggcacccgctacccgacgaccaaacagatccgc
aagctgcggcagctgcacgggctgctgcaggcccgcggggccgaggatgaccggactcgc
gctgccggccgcggcgacctgggcgccgcgctggccgactggccgctgtggtacgctgac
tggatggacgggcagctggtggagaaggggcggcaggacatgcgacagctggccctgcgc
ctggcctcccttttccctgccctcttcagccgagagaactacggccgcctgcagctagtc
accagctccaagcaccgctgcgtggacagcggcgccgccttcctgcaagggctctggcag
cactaccacccagggttaccgccacccgacatcgcagatatggagtgtggacctccaaga
attaatgataaattaatgaggttctttgatcattgtgagaagtttttaactcaagtggaa
aggaatgctactgctctttatcatgtagaagccttcaaaactggaccagaaatgcagaac
atattaaaaaaagttgcagatattttgcaagtgccagtcaacaacttaaatgcagattta
attcaggtagcttttttcacctgttcctttgacctggcaattaaaggtgttaaatctcct
tggtgtgatgtttttgacatagatgatgcaaaggttttagaatatttaaatgatctgaaa
caatattggaaaagaggatatgggtattctattaacagtcgatccagctgcaccctgttt
caggatatctttcagcacttggacaaagcagttaaacaaaaacaacgttctcaaccagtt
tcctctccagtcatcctccagtttggccatgcagagacccttcttccactgctttctctc
atgggctacttcaaagacaaggaacccctaacagcctacaattacaaggagcaaatgcat
cggaagttccgaagtggtcacattgtaccctatgcttcaaacctgatatttgtgctttac
cattgtaaaaatgctaagactcctaaagaagaattccgagtgcagatgttactgaatgaa
aaagtgttaccattggctcactcacaagaaactgtttctttgtatgaagatctgaagaac
cactataaggacatccttcagagttgtcataccagtgaagaatgtgaactaccaaaggtg
aacacgtctgatgagctatga

DBGET integrated database retrieval system